BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32083 (516 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0838 - 8185083-8185910 27 6.8 04_04_1358 + 32869222-32869306,32869947-32870008,32870301-328703... 27 8.9 02_05_1192 + 34872348-34873739 27 8.9 >08_01_0838 - 8185083-8185910 Length = 275 Score = 27.5 bits (58), Expect = 6.8 Identities = 31/116 (26%), Positives = 45/116 (38%) Frame = +3 Query: 45 DHRCSSRPCGYRHRCPPTEDYPKIVRSEFDASPDGAYNYNFETSNGIVRSETGELKEALD 224 DHR SS CG HR +D E DA + E N + R T + A Sbjct: 163 DHRDSSTTCGCHHRPEYADDSDDDDDDEEDAIKKAEEEESLE-HNELWREFTDKYIIASG 221 Query: 225 DDNKPHVIVAVRGSYSYTNTDGKPETITYXADETGYHAQGESIPQVASATS*TXKF 392 D++ + A+ Y T D ET T D+ H + E + + ++ KF Sbjct: 222 YDDRFKEMDAIGEVYFDTTLD--EETRTDMIDKLWRHIEKELSDRARAVSTGKFKF 275 >04_04_1358 + 32869222-32869306,32869947-32870008,32870301-32870393, 32870640-32870761,32873139-32873167,32873586-32873891, 32873977-32874035,32874148-32874279,32874414-32874455, 32874560-32875093,32875189-32875379,32875538-32876027, 32876273-32876335,32876704-32876805,32876895-32877215, 32877294-32877386,32877484-32877585,32877718-32877822, 32877933-32878066,32878429-32878612,32879226-32879357, 32879447-32879559,32879628-32879709,32880328-32881992 Length = 1746 Score = 27.1 bits (57), Expect = 8.9 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = -1 Query: 432 QSCIKASSLKSIQGIXKFSSWRRRPEE*IHPEHGIQSRQ 316 ++ + S K +G S RR + +HP HG+ S+Q Sbjct: 1701 KATVVPKSEKDTEGFTVVSKRRRSKQHFVHPIHGLYSQQ 1739 >02_05_1192 + 34872348-34873739 Length = 463 Score = 27.1 bits (57), Expect = 8.9 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +2 Query: 401 DLSDEALIQDCVAKHPPHSLVTRY 472 DL+D +DC+ +PP +LV Y Sbjct: 418 DLADAGAWEDCIHDYPPANLVNPY 441 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,731,798 Number of Sequences: 37544 Number of extensions: 234043 Number of successful extensions: 612 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 597 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 612 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1118831240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -