BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32081 (332 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_06_0165 + 11380807-11383585,11383628-11383734,11383782-11384018 27 3.7 01_06_0564 - 30271749-30271759,30271847-30271922,30272878-302729... 26 8.5 >10_06_0165 + 11380807-11383585,11383628-11383734,11383782-11384018 Length = 1040 Score = 27.1 bits (57), Expect = 3.7 Identities = 16/40 (40%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = -2 Query: 223 LSHFFQFGRAAKSLSPTKPA-VRNFVPKIQYLLICILNYI 107 LS Q G L T P+ + N +PKIQYL++ LN++ Sbjct: 247 LSSLVQIGVEMNELDGTLPSDLGNALPKIQYLILA-LNHL 285 >01_06_0564 - 30271749-30271759,30271847-30271922,30272878-30272919, 30273065-30273206,30273278-30273339,30273460-30273526, 30273644-30273834 Length = 196 Score = 25.8 bits (54), Expect = 8.5 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -2 Query: 229 VLLSHFFQFGRAAKSLSPTKPAVRNFVPKIQ 137 +LL F G+ LSPT P+VR FV + + Sbjct: 43 LLLLLFSASGKLYHFLSPTVPSVREFVERYE 73 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,800,550 Number of Sequences: 37544 Number of extensions: 132879 Number of successful extensions: 256 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 248 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 256 length of database: 14,793,348 effective HSP length: 72 effective length of database: 12,090,180 effective search space used: 459426840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -