BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32076 (516 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC902.06 |mto2||MT organizer Mto2|Schizosaccharomyces pombe|ch... 28 0.72 SPBC1198.07c |||mannan endo-1,6-alpha-mannosidase |Schizosacchar... 25 5.1 >SPBC902.06 |mto2||MT organizer Mto2|Schizosaccharomyces pombe|chr 2|||Manual Length = 397 Score = 28.3 bits (60), Expect = 0.72 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Frame = +1 Query: 280 RFYSKMYNYMTLPRSVDSKASN*NDIKKESTRRATK--*NQSLHPHTTILK 426 RF+SK++ + T P + S AS+ STR + SLHP T L+ Sbjct: 321 RFHSKIHTHSTPPSQMYSAASHFRYRSDPSTRHVSNSTNKSSLHPSPTSLR 371 >SPBC1198.07c |||mannan endo-1,6-alpha-mannosidase |Schizosaccharomyces pombe|chr 2|||Manual Length = 507 Score = 25.4 bits (53), Expect = 5.1 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -2 Query: 401 RDWFYFVARRVDSFFISFQF 342 R+W++F+ R SFF F F Sbjct: 58 RNWWFFIKMRYLSFFFEFFF 77 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,932,334 Number of Sequences: 5004 Number of extensions: 35813 Number of successful extensions: 73 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 72 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 73 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 208287218 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -