BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32074 (516 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56793| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 7e-07 SB_1371| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_17017| Best HMM Match : TIL (HMM E-Value=4.8) 36 0.020 SB_35070| Best HMM Match : TIL (HMM E-Value=8.6) 36 0.020 SB_25694| Best HMM Match : RVT_1 (HMM E-Value=1.9e-22) 32 0.32 SB_15796| Best HMM Match : RVT_1 (HMM E-Value=0.00082) 32 0.32 SB_52091| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 >SB_56793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 50.8 bits (116), Expect = 7e-07 Identities = 25/36 (69%), Positives = 27/36 (75%) Frame = +1 Query: 343 KKRAPWLILPVVICLSQRLSHACLSASRIKAIPRMA 450 ++ A WLILPVVICLSQRLSHACLS S RMA Sbjct: 126 RRVAIWLILPVVICLSQRLSHACLSISTCTVKLRMA 161 >SB_1371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 50.0 bits (114), Expect = 1e-06 Identities = 25/36 (69%), Positives = 27/36 (75%) Frame = +1 Query: 343 KKRAPWLILPVVICLSQRLSHACLSASRIKAIPRMA 450 ++ A WLILPVVICLSQRLSHACLS S RMA Sbjct: 102 RRVAIWLILPVVICLSQRLSHACLSISTRTVKLRMA 137 >SB_17017| Best HMM Match : TIL (HMM E-Value=4.8) Length = 171 Score = 35.9 bits (79), Expect = 0.020 Identities = 16/20 (80%), Positives = 18/20 (90%) Frame = +1 Query: 343 KKRAPWLILPVVICLSQRLS 402 ++ A WLILPVVICLSQRLS Sbjct: 147 RRVAIWLILPVVICLSQRLS 166 >SB_35070| Best HMM Match : TIL (HMM E-Value=8.6) Length = 147 Score = 35.9 bits (79), Expect = 0.020 Identities = 16/20 (80%), Positives = 18/20 (90%) Frame = +1 Query: 343 KKRAPWLILPVVICLSQRLS 402 ++ A WLILPVVICLSQRLS Sbjct: 123 RRVAIWLILPVVICLSQRLS 142 >SB_25694| Best HMM Match : RVT_1 (HMM E-Value=1.9e-22) Length = 1797 Score = 31.9 bits (69), Expect = 0.32 Identities = 14/45 (31%), Positives = 25/45 (55%) Frame = +2 Query: 377 LYACLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYLDNCGNS 511 L CL D A+ ++ + +Y W+N+ +LV L ++ CG+S Sbjct: 447 LMTCLYDKAVFLTDEEYAAKYGRWVNVQMLVEEPELHFIAKCGSS 491 >SB_15796| Best HMM Match : RVT_1 (HMM E-Value=0.00082) Length = 1304 Score = 31.9 bits (69), Expect = 0.32 Identities = 14/45 (31%), Positives = 25/45 (55%) Frame = +2 Query: 377 LYACLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYLDNCGNS 511 L CL D A+ ++ + +Y W+N+ +LV L ++ CG+S Sbjct: 866 LMTCLYDKAVFLTDEEYAAKYGRWVNVQMLVEEPELHFIAKCGSS 910 >SB_52091| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1775 Score = 28.7 bits (61), Expect = 3.0 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +1 Query: 271 PKHDHAVRAFLRPMRCDVLVFELTKK-RAPWLILPVVICLSQRLSHACLSASRI 429 PK + + M +V + + KK R P L + V++ +SQ LSHAC R+ Sbjct: 46 PKEEEVEQKEEEEMPDEVEMIPMAKKPRKPSLGVAVLLRVSQVLSHACFENHRL 99 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,873,190 Number of Sequences: 59808 Number of extensions: 212290 Number of successful extensions: 468 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 447 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 468 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1148326654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -