BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32070 (506 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY752902-1|AAV30076.1| 106|Anopheles gambiae peroxidase 8 protein. 26 0.64 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 23 5.9 AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein. 23 5.9 >AY752902-1|AAV30076.1| 106|Anopheles gambiae peroxidase 8 protein. Length = 106 Score = 26.2 bits (55), Expect = 0.64 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = +1 Query: 367 LDMFRKHGLSEEVHDKFREMNENKYTMLVYNTLLKPKSAGR 489 + F ++ +EEV + R +N +Y +VYN L P GR Sbjct: 29 IQRFNRNLSNEEVFQRARHLNIAQYQHIVYNEWL-PNFLGR 68 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 23.0 bits (47), Expect = 5.9 Identities = 8/25 (32%), Positives = 16/25 (64%) Frame = +3 Query: 237 QYWRLNRHQPTQSYRFRKHNRPELS 311 Q + +HQ Q ++ + H++P+LS Sbjct: 1315 QQQQQQQHQQHQQHQLQHHHQPQLS 1339 >AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein. Length = 1152 Score = 23.0 bits (47), Expect = 5.9 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = +1 Query: 55 LRELDLASTWKT 90 LRELDL+S W T Sbjct: 507 LRELDLSSNWLT 518 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 553,700 Number of Sequences: 2352 Number of extensions: 10626 Number of successful extensions: 12 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 45668772 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -