BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32068 (516 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY052622-1|AAL15470.1| 290|Tribolium castaneum kynurenine 3-mon... 24 0.70 AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-mon... 24 0.70 AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-mon... 24 0.70 >AY052622-1|AAL15470.1| 290|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 290 Score = 24.2 bits (50), Expect = 0.70 Identities = 18/52 (34%), Positives = 25/52 (48%), Gaps = 1/52 (1%) Frame = +1 Query: 82 KFAL-RSLPSATLEKGGREAPXVGLEGVPRELNSPLVELFEGVLKGRHCSLP 234 KFA RS+ A +G + VG+E + E P+ LKGR S+P Sbjct: 45 KFARGRSINMALSNRGRKALRAVGIEKIILESAIPMKGRLLHDLKGRTTSVP 96 >AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 24.2 bits (50), Expect = 0.70 Identities = 18/52 (34%), Positives = 25/52 (48%), Gaps = 1/52 (1%) Frame = +1 Query: 82 KFAL-RSLPSATLEKGGREAPXVGLEGVPRELNSPLVELFEGVLKGRHCSLP 234 KFA RS+ A +G + VG+E + E P+ LKGR S+P Sbjct: 45 KFARGRSINMALSNRGRKALRAVGIEKIILESAIPMKGRLLHDLKGRTTSVP 96 >AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 24.2 bits (50), Expect = 0.70 Identities = 18/52 (34%), Positives = 25/52 (48%), Gaps = 1/52 (1%) Frame = +1 Query: 82 KFAL-RSLPSATLEKGGREAPXVGLEGVPRELNSPLVELFEGVLKGRHCSLP 234 KFA RS+ A +G + VG+E + E P+ LKGR S+P Sbjct: 45 KFARGRSINMALSNRGRKALRAVGIEKIILESAIPMKGRLLHDLKGRTTSVP 96 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 116,091 Number of Sequences: 336 Number of extensions: 2294 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12363686 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -