BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32068 (516 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC3G9.01 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||... 27 1.7 SPAC22F8.12c |shf1||small histone ubiquitination factor Shf1|Sch... 26 3.8 SPCC736.03c |||phenylalanyl-tRNA synthetase|Schizosaccharomyces ... 25 5.1 SPAP27G11.10c |nup184||nucleoporin Nup184|Schizosaccharomyces po... 25 5.1 SPCC290.03c |nup186||nucleoporin Nup186|Schizosaccharomyces pomb... 25 6.7 SPBC1683.01 |||inorganic phosphate transporter |Schizosaccharomy... 25 6.7 SPAC17G8.14c |pck1|SPAC22H10.01c|protein kinase C |Schizosacchar... 25 8.9 >SPAC3G9.01 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 462 Score = 27.1 bits (57), Expect = 1.7 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = -2 Query: 215 PLRTPSNSSTRGEFSSRGTPSNPTXGASLPPFS 117 PLRTP++SS TPS P+ L F+ Sbjct: 237 PLRTPTSSSKTFVIVDHSTPSPPSIRTKLEAFA 269 >SPAC22F8.12c |shf1||small histone ubiquitination factor Shf1|Schizosaccharomyces pombe|chr 1|||Manual Length = 165 Score = 25.8 bits (54), Expect = 3.8 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -2 Query: 209 RTPSNSSTRGEFSSRGTPSN 150 R PSN+STR F + T +N Sbjct: 71 RVPSNNSTRASFGAASTDTN 90 >SPCC736.03c |||phenylalanyl-tRNA synthetase|Schizosaccharomyces pombe|chr 3|||Manual Length = 429 Score = 25.4 bits (53), Expect = 5.1 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +1 Query: 331 AIKAYGVPDIDVFQTVDLWEKKDIXPSXEDTVCPRS 438 A+ YG+PDI +F ++D K P+ T P S Sbjct: 304 AMILYGIPDIRLFWSLDERFSKQFLPNKISTFKPFS 339 >SPAP27G11.10c |nup184||nucleoporin Nup184|Schizosaccharomyces pombe|chr 1|||Manual Length = 1564 Score = 25.4 bits (53), Expect = 5.1 Identities = 22/82 (26%), Positives = 34/82 (41%) Frame = -1 Query: 363 IDVGYTVCFDCXTXSL*CSPSF*TVPPVVLILGTEPGFSLLMSWQRTVPSLEDTLK*FHQ 184 ID G+++C + ++ S +F ++ VL P F +L T+ SL D + Sbjct: 265 IDTGFSMCKEITNVAIIISINFISLEKQVLSFKDNPSFFMLSG--NTIISLHDMITQLSN 322 Query: 183 GGI*LPRDALQSHXWGFPSSLL 118 I A S WG LL Sbjct: 323 DSI----GAAVSLTWGIALHLL 340 >SPCC290.03c |nup186||nucleoporin Nup186|Schizosaccharomyces pombe|chr 3|||Manual Length = 1647 Score = 25.0 bits (52), Expect = 6.7 Identities = 9/13 (69%), Positives = 12/13 (92%) Frame = -2 Query: 101 SDLSANLTFPENM 63 S+L+ NLTFPEN+ Sbjct: 727 SELNVNLTFPENL 739 >SPBC1683.01 |||inorganic phosphate transporter |Schizosaccharomyces pombe|chr 2|||Manual Length = 573 Score = 25.0 bits (52), Expect = 6.7 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -3 Query: 241 DELAKNSAVP*GHPQI 194 DEL KN +V GHP+I Sbjct: 284 DELVKNPSVTKGHPEI 299 >SPAC17G8.14c |pck1|SPAC22H10.01c|protein kinase C |Schizosaccharomyces pombe|chr 1|||Manual Length = 988 Score = 24.6 bits (51), Expect = 8.9 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = -2 Query: 155 SNPTXGASLPPFSRVALGSDLSANLTFPEN 66 S PT + L P S +L S AN + PE+ Sbjct: 621 STPTPASVLAPPSSASLSSSKDANRSVPES 650 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,018,570 Number of Sequences: 5004 Number of extensions: 38268 Number of successful extensions: 120 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 116 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 120 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 208287218 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -