BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32068 (516 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 25 2.0 AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-s... 25 2.0 AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-spe... 25 2.0 AY578802-1|AAT07307.1| 108|Anopheles gambiae FK506-binding prot... 23 8.1 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 24.6 bits (51), Expect = 2.0 Identities = 16/59 (27%), Positives = 22/59 (37%) Frame = +1 Query: 16 HHSQHFGKKHSHNSHNMFSGNVKFALRSLPSATLEKGGREAPXVGLEGVPRELNSPLVE 192 HH H G H H + G A S P+ L + P V +E + P V+ Sbjct: 1315 HHHLHHGHHHHHGGEGVPMGPAN-AAPSSPAGVLV---AKVPPVAVEDIENSKQQPPVQ 1369 >AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-specific zinc-fingerC isoform protein. Length = 593 Score = 24.6 bits (51), Expect = 2.0 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +1 Query: 1 GTXAAHHSQHFGKKHSHNSHNMFS 72 GT HH+ H+ H + HNMF+ Sbjct: 496 GTDLPHHT-HYQLHHQMSYHNMFT 518 >AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-specific zinc-fingerC isoform protein. Length = 569 Score = 24.6 bits (51), Expect = 2.0 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +1 Query: 1 GTXAAHHSQHFGKKHSHNSHNMFS 72 GT HH+ H+ H + HNMF+ Sbjct: 472 GTDLPHHT-HYQLHHQMSYHNMFT 494 >AY578802-1|AAT07307.1| 108|Anopheles gambiae FK506-binding protein protein. Length = 108 Score = 22.6 bits (46), Expect = 8.1 Identities = 11/35 (31%), Positives = 17/35 (48%) Frame = -3 Query: 277 VDLGDRARXQLVDELAKNSAVP*GHPQIVPPGGNL 173 + +G RA+ + A S GHP ++PP L Sbjct: 67 MSVGQRAKLVCSPDYAYGSR---GHPGVIPPNARL 98 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 524,821 Number of Sequences: 2352 Number of extensions: 10621 Number of successful extensions: 21 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46937349 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -