BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32068 (516 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 24 1.1 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 21 5.7 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 21 5.7 DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization prot... 21 10.0 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 23.8 bits (49), Expect = 1.1 Identities = 10/40 (25%), Positives = 19/40 (47%) Frame = +3 Query: 315 TNXQXCNQSIRCTRHRCVPNRGSMGEKRHRXKX*GHCLPS 434 +N C++ R T R + + + +RH + HC P+ Sbjct: 1659 SNYNTCDRIKRGTVIRSIRSHSTWDPRRHMYEELNHCAPN 1698 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 21.4 bits (43), Expect = 5.7 Identities = 8/20 (40%), Positives = 10/20 (50%) Frame = +1 Query: 343 YGVPDIDVFQTVDLWEKKDI 402 Y D D+F LW K +I Sbjct: 116 YHAKDFDIFFKTALWAKNNI 135 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 21.4 bits (43), Expect = 5.7 Identities = 8/20 (40%), Positives = 10/20 (50%) Frame = +1 Query: 343 YGVPDIDVFQTVDLWEKKDI 402 Y D D+F LW K +I Sbjct: 116 YHAKDFDIFFKTALWAKNNI 135 >DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization protein protein. Length = 250 Score = 20.6 bits (41), Expect = 10.0 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +2 Query: 65 CSLGTSSSR*DRFQAQPWRREEGKP 139 CSLGT+SS ++ R G P Sbjct: 176 CSLGTASSTSSTASSRNSDRSAGSP 200 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 137,122 Number of Sequences: 438 Number of extensions: 2590 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14354847 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -