BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32067 (492 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAPB15E9.02c |||dubious|Schizosaccharomyces pombe|chr 1|||Manual 31 0.071 SPAC17A2.10c |||sequence orphan|Schizosaccharomyces pombe|chr 1|... 26 3.5 >SPAPB15E9.02c |||dubious|Schizosaccharomyces pombe|chr 1|||Manual Length = 188 Score = 31.5 bits (68), Expect = 0.071 Identities = 16/42 (38%), Positives = 24/42 (57%) Frame = +3 Query: 165 DAFLVKQIRFYLLYSHYSVYFFLFTSFAYSFIFTLKFHVILL 290 D+ +V F+ +S +S + FLFTS ++F F L H LL Sbjct: 101 DSNVVPFFCFFFYFSLFSFFSFLFTSLHFNFFFRLCRHKHLL 142 >SPAC17A2.10c |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 230 Score = 25.8 bits (54), Expect = 3.5 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = +2 Query: 188 SFLFIIQSL*CVFFFVHEFCLFVYFYFEISCDIINLL 298 SFLF + + V+F F++F+F C ++ L Sbjct: 134 SFLFFLSQIFIVYFSSFPILHFLFFFFLCVCVFLSFL 170 Score = 25.0 bits (52), Expect = 6.2 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +3 Query: 198 LLYSHYSVYFFLFTSFAYSFIFTLKFHVILLIS 296 LL + + FFL SF++SF+F L I+ S Sbjct: 116 LLLFFFFLLFFLSFSFSFSFLFFLSQIFIVYFS 148 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,662,048 Number of Sequences: 5004 Number of extensions: 29318 Number of successful extensions: 73 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 69 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 72 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 192109570 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -