BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32067 (492 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45929| Best HMM Match : ANF_receptor (HMM E-Value=4.8e-24) 30 0.90 SB_40372| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 >SB_45929| Best HMM Match : ANF_receptor (HMM E-Value=4.8e-24) Length = 1001 Score = 30.3 bits (65), Expect = 0.90 Identities = 16/49 (32%), Positives = 27/49 (55%), Gaps = 2/49 (4%) Frame = +1 Query: 121 CNACL--ILDFCNDKLLMHF*LNKFVFIYYTVIIVCIFFCSRVLLIRLF 261 C C+ +L F L++ F + F +Y+ +I CIF C+ ++L LF Sbjct: 641 CVVCVFVVLVFVIIGLIVAFVVPMFPNLYFGIIGSCIFLCTTIILALLF 689 >SB_40372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 27.1 bits (57), Expect = 8.4 Identities = 9/25 (36%), Positives = 17/25 (68%) Frame = -3 Query: 124 YTLRRHRSLLAVCSFGIDLISISKT 50 Y L +HR+++ C+F D ++SK+ Sbjct: 59 YVLNKHRNVIQTCAFSHDSKTVSKS 83 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,520,170 Number of Sequences: 59808 Number of extensions: 191538 Number of successful extensions: 365 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 353 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 365 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1050596726 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -