BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32067 (492 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Y17699-1|CAA76819.1| 81|Anopheles gambiae hypothetical protein... 25 1.4 CR954257-10|CAJ14161.1| 519|Anopheles gambiae Sply, Sphingosine... 25 1.9 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 23 7.5 AY705401-1|AAU12510.1| 490|Anopheles gambiae nicotinic acetylch... 22 9.9 AY705400-1|AAU12509.1| 490|Anopheles gambiae nicotinic acetylch... 22 9.9 >Y17699-1|CAA76819.1| 81|Anopheles gambiae hypothetical protein protein. Length = 81 Score = 25.0 bits (52), Expect = 1.4 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +1 Query: 301 MICFLLLMCCHSNSTVAE 354 ++C L ++CC ST AE Sbjct: 9 LVCLLSVVCCEEASTAAE 26 >CR954257-10|CAJ14161.1| 519|Anopheles gambiae Sply, Sphingosine-phosphate lyase protein. Length = 519 Score = 24.6 bits (51), Expect = 1.9 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = -1 Query: 423 MNLFKCILALXDSTNIPVQGQACLGNSTI 337 M+ + I AL NIPV ACLG I Sbjct: 255 MDDIEAIAALGRKYNIPVHVDACLGGFLI 283 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 22.6 bits (46), Expect = 7.5 Identities = 13/54 (24%), Positives = 28/54 (51%), Gaps = 3/54 (5%) Frame = -1 Query: 447 ITVSNAEV---MNLFKCILALXDSTNIPVQGQACLGNSTIGMTTH*K*ETNHLK 295 I++ AEV + + + + D+T+ P + + S I TTH + + +H++ Sbjct: 1427 ISLRKAEVKQRIGSWNYVETIVDTTHFPTETKLVFDISFIPSTTHGRIDIDHIR 1480 >AY705401-1|AAU12510.1| 490|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 6 protein. Length = 490 Score = 22.2 bits (45), Expect = 9.9 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +2 Query: 233 VHEFCLFVYFYFEISCDIINLL 298 V FCLFV+ F I + LL Sbjct: 461 VDRFCLFVFTLFTIIATVTVLL 482 >AY705400-1|AAU12509.1| 490|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 6 protein. Length = 490 Score = 22.2 bits (45), Expect = 9.9 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +2 Query: 233 VHEFCLFVYFYFEISCDIINLL 298 V FCLFV+ F I + LL Sbjct: 461 VDRFCLFVFTLFTIIATVTVLL 482 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 412,470 Number of Sequences: 2352 Number of extensions: 6819 Number of successful extensions: 29 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 43554477 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -