BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32067 (492 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 24 1.0 L10433-1|AAA27732.1| 149|Apis mellifera transposase protein. 23 2.3 AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive... 22 3.1 S76957-1|AAB33932.1| 169|Apis mellifera olfactory receptor prot... 21 7.1 DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 21 7.1 AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly pro... 21 7.1 S76956-1|AAB33931.1| 168|Apis mellifera olfactory receptor prot... 21 9.4 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 23.8 bits (49), Expect = 1.0 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +3 Query: 225 FFLFTSFAYSFIFTLKFHVI 284 FF+F SFA+ F ++F V+ Sbjct: 278 FFVFLSFAFIFATIIQFAVV 297 >L10433-1|AAA27732.1| 149|Apis mellifera transposase protein. Length = 149 Score = 22.6 bits (46), Expect = 2.3 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = -3 Query: 193 KRICLTRNASVVYHYKNLRLNMHYTLRRHRSLL 95 KR LT SVV+H+ N R H +L + LL Sbjct: 108 KRPELTNRKSVVFHHDNAR--PHTSLVTRQKLL 138 >AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive opsin protein. Length = 371 Score = 22.2 bits (45), Expect = 3.1 Identities = 11/38 (28%), Positives = 19/38 (50%) Frame = +2 Query: 182 TNSFLFIIQSL*CVFFFVHEFCLFVYFYFEISCDIINL 295 T S +F++ C FF + + +F+Y F + NL Sbjct: 81 TPSNMFVVNLAICDFFMMIKTPIFIYNSFNTGFALGNL 118 >S76957-1|AAB33932.1| 169|Apis mellifera olfactory receptor protein. Length = 169 Score = 21.0 bits (42), Expect = 7.1 Identities = 9/21 (42%), Positives = 13/21 (61%), Gaps = 2/21 (9%) Frame = +1 Query: 178 LNKFVFIYYTVIIVCI--FFC 234 LNK V ++YT +I + F C Sbjct: 149 LNKVVSVFYTAVIPMLNPFIC 169 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 21.0 bits (42), Expect = 7.1 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = -3 Query: 121 TLRRHRSLLAVCSFGIDLISIS 56 T R ++ C+FGID+ S++ Sbjct: 178 TARFTTDVIGSCAFGIDMSSMT 199 >AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly protein MRJP2 protein. Length = 452 Score = 21.0 bits (42), Expect = 7.1 Identities = 7/14 (50%), Positives = 12/14 (85%) Frame = -1 Query: 309 TNHLKRLIISHEIS 268 +NHLK++ I H+I+ Sbjct: 163 SNHLKQIEIPHDIA 176 >S76956-1|AAB33931.1| 168|Apis mellifera olfactory receptor protein. Length = 168 Score = 20.6 bits (41), Expect = 9.4 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +1 Query: 178 LNKFVFIYYTVII 216 LNK V ++YT +I Sbjct: 148 LNKVVSVFYTAVI 160 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 108,930 Number of Sequences: 438 Number of extensions: 1950 Number of successful extensions: 7 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 13544190 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -