BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32064 (370 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_07_0172 + 13804803-13805293,13805423-13805537,13805766-138058... 28 2.0 08_01_0386 + 3424561-3425346 27 3.5 04_03_0755 + 19310648-19311603,19312420-19312633 27 4.6 12_01_1113 - 11888691-11888900,11891794-11892243,11892274-118929... 27 6.1 08_01_0514 + 4481383-4481903,4482532-4484590,4485038-4485107,448... 27 6.1 05_02_0049 - 6083364-6084111,6084140-6084246 27 6.1 03_01_0534 + 3996479-3997458,3997938-3998265 27 6.1 >10_07_0172 + 13804803-13805293,13805423-13805537,13805766-13805831, 13805921-13806009,13806103-13806193,13806312-13806458, 13806575-13806667,13806745-13806846,13806957-13807541, 13808523-13808813,13808866-13808937 Length = 713 Score = 28.3 bits (60), Expect = 2.0 Identities = 17/58 (29%), Positives = 25/58 (43%) Frame = -3 Query: 284 VVHRDLSCQIHPVHVHRNHLFPSFLVVHRVLHHGNHDLVDLPSLAGSWKQEQVKIIYY 111 V H + + +H HL P H + H G DL + AGS Q K+++Y Sbjct: 629 VPHDETVLVVEELHSDLGHLTPGAGAAHHLHHDGKFDLGIHAAQAGS-IYSQAKLMFY 685 >08_01_0386 + 3424561-3425346 Length = 261 Score = 27.5 bits (58), Expect = 3.5 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = -1 Query: 367 SSPSITASAHRATSKTTWASTH 302 SSP+ ASA A S WAS H Sbjct: 23 SSPAAAASASPAASAVVWASNH 44 >04_03_0755 + 19310648-19311603,19312420-19312633 Length = 389 Score = 27.1 bits (57), Expect = 4.6 Identities = 19/47 (40%), Positives = 26/47 (55%) Frame = +3 Query: 189 VEDAVDHQE*GEEVVSMYVDGVDLA*EVAVDHLGAGRLCVEAHVVLE 329 VEDA+ EE V +YV+ + LA VAV GAG E +++E Sbjct: 313 VEDAISRLLRNEEDV-VYVEKLVLAFNVAVRKSGAGAARAEERLMVE 358 >12_01_1113 - 11888691-11888900,11891794-11892243,11892274-11892950, 11893396-11893957,11894121-11894207 Length = 661 Score = 26.6 bits (56), Expect = 6.1 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +1 Query: 214 NEGKRWFRCTWTGWIWHERSRWTT*GR 294 N G W+R +T W+ E + WT GR Sbjct: 61 NGGPDWYR-EYTLWVLEEENSWTKVGR 86 >08_01_0514 + 4481383-4481903,4482532-4484590,4485038-4485107, 4485434-4485660,4486238-4486324,4486408-4487114, 4487206-4487270,4487323-4487837,4487898-4487991, 4488116-4488398,4488494-4488689,4488913-4489254 Length = 1721 Score = 26.6 bits (56), Expect = 6.1 Identities = 8/23 (34%), Positives = 17/23 (73%) Frame = +3 Query: 54 FFVVVLILRDIRSWYAIDIVIYN 122 +F+V+ +RD +W AI++ ++N Sbjct: 175 YFIVIDDVRDAEAWKAIELALFN 197 >05_02_0049 - 6083364-6084111,6084140-6084246 Length = 284 Score = 26.6 bits (56), Expect = 6.1 Identities = 15/39 (38%), Positives = 23/39 (58%), Gaps = 1/39 (2%) Frame = -1 Query: 358 SITASAHRATSKTTWASTHRRPAPRWSTATSH-AKSTPS 245 S ASA R S ++W S+ PA R + +T+ A ++PS Sbjct: 52 SAAASAGRCWSSSSWRSSPPSPAARSTCSTARTAPASPS 90 >03_01_0534 + 3996479-3997458,3997938-3998265 Length = 435 Score = 26.6 bits (56), Expect = 6.1 Identities = 10/41 (24%), Positives = 21/41 (51%) Frame = -1 Query: 361 PSITASAHRATSKTTWASTHRRPAPRWSTATSHAKSTPSTY 239 P++ ++ + WA+ +R PRW + + A + +TY Sbjct: 276 PTLKSTVRGLLKEGGWAACYRGLGPRWGSMSLSAATMVTTY 316 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,408,843 Number of Sequences: 37544 Number of extensions: 166989 Number of successful extensions: 568 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 559 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 567 length of database: 14,793,348 effective HSP length: 74 effective length of database: 12,015,092 effective search space used: 576724416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -