BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32060 (511 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 25 1.1 AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro... 23 6.0 U50479-1|AAA93478.1| 151|Anopheles gambiae protein ( Anopheles ... 23 7.9 DQ370045-1|ABD18606.1| 285|Anopheles gambiae putative TIL domai... 23 7.9 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 25.4 bits (53), Expect = 1.1 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -1 Query: 109 LCNFV*SKRYRKKIVNQCSRIFERKKKKKNS 17 LC V S K+IV C R F+RK+ + S Sbjct: 1237 LCERVGSFTKLKRIVAYCHRFFDRKRIHRKS 1267 >AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein. Length = 2051 Score = 23.0 bits (47), Expect = 6.0 Identities = 6/17 (35%), Positives = 13/17 (76%) Frame = -1 Query: 490 IHSRIIYHKKIFNYSYK 440 +H Y++++FNY+Y+ Sbjct: 1637 VHPDFDYYERMFNYAYR 1653 >U50479-1|AAA93478.1| 151|Anopheles gambiae protein ( Anopheles gambiae putativeribosomal protein S13 mRNA, complete cds. ). Length = 151 Score = 22.6 bits (46), Expect = 7.9 Identities = 14/43 (32%), Positives = 21/43 (48%), Gaps = 7/43 (16%) Frame = +3 Query: 177 FTNGNICKXGFKKIGLKPN-------QIRKSIDFKKKLFYNHR 284 F NGN K +GLKP+ I+K++ +K L N + Sbjct: 65 FVNGNKVLRIMKAVGLKPDIPEDLYFLIKKAVSIRKHLERNRK 107 >DQ370045-1|ABD18606.1| 285|Anopheles gambiae putative TIL domain protein protein. Length = 285 Score = 22.6 bits (46), Expect = 7.9 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +3 Query: 168 ARNFTNGNICKXGF 209 A FT+G +CK GF Sbjct: 88 AAGFTSGCVCKKGF 101 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 440,941 Number of Sequences: 2352 Number of extensions: 8203 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46091631 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -