BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32060 (511 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z74026-5|CAA98419.3| 3517|Caenorhabditis elegans Hypothetical pr... 30 1.1 Z72513-4|CAA96672.3| 3517|Caenorhabditis elegans Hypothetical pr... 30 1.1 Z66567-1|CAA91491.1| 887|Caenorhabditis elegans Hypothetical pr... 27 6.0 >Z74026-5|CAA98419.3| 3517|Caenorhabditis elegans Hypothetical protein T04F3.1 protein. Length = 3517 Score = 29.9 bits (64), Expect = 1.1 Identities = 18/34 (52%), Positives = 23/34 (67%), Gaps = 3/34 (8%) Frame = -1 Query: 112 ILCNFV*SKRYRKKIVNQCS---RIFERKKKKKN 20 ILC+F SK Y K+V S +IF+RKKKKK+ Sbjct: 635 ILCHFRFSKFYIYKMVFDISKIVKIFKRKKKKKD 668 >Z72513-4|CAA96672.3| 3517|Caenorhabditis elegans Hypothetical protein T04F3.1 protein. Length = 3517 Score = 29.9 bits (64), Expect = 1.1 Identities = 18/34 (52%), Positives = 23/34 (67%), Gaps = 3/34 (8%) Frame = -1 Query: 112 ILCNFV*SKRYRKKIVNQCS---RIFERKKKKKN 20 ILC+F SK Y K+V S +IF+RKKKKK+ Sbjct: 635 ILCHFRFSKFYIYKMVFDISKIVKIFKRKKKKKD 668 >Z66567-1|CAA91491.1| 887|Caenorhabditis elegans Hypothetical protein ZK455.1 protein. Length = 887 Score = 27.5 bits (58), Expect = 6.0 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +3 Query: 168 ARNFTNGNICKXGFKKIGLKPNQIRKSI 251 A++F+ G K FK GLKP KS+ Sbjct: 385 AQDFSKGLTDKISFKAFGLKPEDATKSV 412 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,856,016 Number of Sequences: 27780 Number of extensions: 185649 Number of successful extensions: 305 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 302 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 303 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 988489374 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -