BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32051 (341 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1685.09 |rps29||40S ribosomal protein S29|Schizosaccharomyce... 87 5e-19 SPBC557.03c |pim1|dcd1, ptr2|GDP/GTP exchange factor |Schizosacc... 24 7.5 SPAC4A8.11c |fas2|lsd1|fatty acid synthase alpha subunit Lsd1 |S... 23 9.8 SPAC1687.21 ||SPAC222.01|phosphoglycerate mutase family |Schizos... 23 9.8 >SPBC1685.09 |rps29||40S ribosomal protein S29|Schizosaccharomyces pombe|chr 2|||Manual Length = 56 Score = 87.4 bits (207), Expect = 5e-19 Identities = 37/54 (68%), Positives = 41/54 (75%) Frame = +2 Query: 53 MGHANIWYSHPRXYGQGSRSCRSCSNRHGLIRKYGLNICRQCFREYAHDIGFKK 214 M H N+W+SHPR YG+GSR C R GLIRKYGLNI RQ FREYA+DIGF K Sbjct: 1 MAHENVWFSHPRKYGKGSRQCAHTGRRLGLIRKYGLNISRQSFREYANDIGFVK 54 >SPBC557.03c |pim1|dcd1, ptr2|GDP/GTP exchange factor |Schizosaccharomyces pombe|chr 2|||Manual Length = 539 Score = 23.8 bits (49), Expect = 7.5 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +2 Query: 95 GQGSRSCRSCSNRHGLIRKYGLNICRQC 178 G GS + N+ G + +GLNI RQC Sbjct: 285 GAGSYHSFAIDNK-GRVYAWGLNITRQC 311 >SPAC4A8.11c |fas2|lsd1|fatty acid synthase alpha subunit Lsd1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1842 Score = 23.4 bits (48), Expect = 9.8 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -3 Query: 147 RIKPCLLEQDRHDRDPCPXLRG*EYQI 67 R P LLE ++ D CP +G YQ+ Sbjct: 438 RSNPTLLEFMQYHIDHCPAEKGETYQL 464 >SPAC1687.21 ||SPAC222.01|phosphoglycerate mutase family |Schizosaccharomyces pombe|chr 1|||Manual Length = 209 Score = 23.4 bits (48), Expect = 9.8 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -3 Query: 186 SLKHCLHMFKPYLRIKP 136 S+K C PYL +KP Sbjct: 54 SMKRCRETIAPYLELKP 70 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,214,519 Number of Sequences: 5004 Number of extensions: 20874 Number of successful extensions: 41 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 41 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 41 length of database: 2,362,478 effective HSP length: 64 effective length of database: 2,042,222 effective search space used: 100068878 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -