BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32048 (516 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U43499-1|AAA93302.1| 278|Anopheles gambiae a-emp protein. 30 0.053 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 23 6.1 AJ549085-1|CAD70159.1| 529|Anopheles gambiae thioredoxin-disulf... 23 8.1 AJ549084-1|CAD70158.1| 505|Anopheles gambiae thioredoxin-disulf... 23 8.1 AJ459821-1|CAD30858.1| 502|Anopheles gambiae thioredoxin reduct... 23 8.1 >U43499-1|AAA93302.1| 278|Anopheles gambiae a-emp protein. Length = 278 Score = 29.9 bits (64), Expect = 0.053 Identities = 9/41 (21%), Positives = 24/41 (58%) Frame = +3 Query: 108 EGAAFPPLMTPQTPVNLYRLGICKSFQMKYQSQEELKLGAK 230 +G+ FPP +T + +++Y +C+ + ++ + ++ G K Sbjct: 177 DGSIFPPRITKNSTLHVYEKDLCRLLPLSFEKEVTVRGGVK 217 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 23.0 bits (47), Expect = 6.1 Identities = 8/32 (25%), Positives = 17/32 (53%) Frame = -3 Query: 220 SFSSSWLWYFIWKLLQIPRRYKLTGVCGVISG 125 + SSW W + ++ + + + + GV+SG Sbjct: 350 AMGSSWQWVYFISMVILGAFFVMNLILGVLSG 381 >AJ549085-1|CAD70159.1| 529|Anopheles gambiae thioredoxin-disulfide reductase protein. Length = 529 Score = 22.6 bits (46), Expect = 8.1 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 197 PKPRGTKAGSQIICVRV 247 P PRGTK G CV V Sbjct: 71 PSPRGTKWGLGGTCVNV 87 >AJ549084-1|CAD70158.1| 505|Anopheles gambiae thioredoxin-disulfide reductase protein. Length = 505 Score = 22.6 bits (46), Expect = 8.1 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 197 PKPRGTKAGSQIICVRV 247 P PRGTK G CV V Sbjct: 47 PSPRGTKWGLGGTCVNV 63 >AJ459821-1|CAD30858.1| 502|Anopheles gambiae thioredoxin reductase protein. Length = 502 Score = 22.6 bits (46), Expect = 8.1 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 197 PKPRGTKAGSQIICVRV 247 P PRGTK G CV V Sbjct: 44 PSPRGTKWGLGGTCVNV 60 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 525,422 Number of Sequences: 2352 Number of extensions: 10665 Number of successful extensions: 57 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 56 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 57 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46937349 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -