BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32045 (341 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 21 3.1 DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride... 21 3.1 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 21 3.1 DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride... 21 3.1 AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 21 4.1 DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor pro... 21 5.4 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 21 5.4 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 21 5.4 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 21.4 bits (43), Expect = 3.1 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +3 Query: 153 ALGRAAGGAKLPSAGLCLNAXKAEASL 233 ALGR AGG S+ L L+ +SL Sbjct: 5 ALGRCAGGGGRLSSVLSLSLTSLASSL 31 >DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride channel variant 3 protein. Length = 475 Score = 21.4 bits (43), Expect = 3.1 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +3 Query: 153 ALGRAAGGAKLPSAGLCLNAXKAEASL 233 ALGR AGG S+ L L+ +SL Sbjct: 5 ALGRCAGGGGRLSSVLSLSLTSLASSL 31 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 21.4 bits (43), Expect = 3.1 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +3 Query: 153 ALGRAAGGAKLPSAGLCLNAXKAEASL 233 ALGR AGG S+ L L+ +SL Sbjct: 5 ALGRCAGGGGRLSSVLSLSLTSLASSL 31 >DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride channel protein. Length = 458 Score = 21.4 bits (43), Expect = 3.1 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +3 Query: 153 ALGRAAGGAKLPSAGLCLNAXKAEASL 233 ALGR AGG S+ L L+ +SL Sbjct: 5 ALGRCAGGGGRLSSVLSLSLTSLASSL 31 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 21.0 bits (42), Expect = 4.1 Identities = 10/32 (31%), Positives = 15/32 (46%) Frame = -1 Query: 176 TTGRSAECMNQMSETAVPPRTEQYYYRNDKPS 81 T G EC+ + AV + E+ DKP+ Sbjct: 249 TVGMRPECVVPEYQCAVKRKEEKAQKEKDKPN 280 >DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor protein. Length = 405 Score = 20.6 bits (41), Expect = 5.4 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = -3 Query: 204 GIIPRMVASHHRPLGRVHEPNVR 136 G I ++AS HR L NVR Sbjct: 219 GRISCVIASRHRNLEATESENVR 241 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 20.6 bits (41), Expect = 5.4 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = +2 Query: 89 CRCDSNTAQYEEEPQFRTFGSCTRP 163 CRCD + E++P+ CT+P Sbjct: 296 CRCDPGYFRAEKDPKKM---PCTQP 317 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 20.6 bits (41), Expect = 5.4 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 132 SFGHLVHALGRAAGGAKLPSAG 197 S LV A+ AGG PSAG Sbjct: 393 SMSALVSAVRSPAGGQLPPSAG 414 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 80,001 Number of Sequences: 438 Number of extensions: 1276 Number of successful extensions: 8 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 50 effective length of database: 124,443 effective search space used: 7839909 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -