BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32043 (430 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicas... 21 3.8 EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglu... 21 6.6 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 6.6 >AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicase protein. Length = 580 Score = 21.4 bits (43), Expect = 3.8 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = -1 Query: 388 GPVVAGAXLSXHQVVRTXDLSERSRADRVHG 296 G V++ S QVV LSE + +HG Sbjct: 22 GGVISEGVASSLQVVALFQLSETTAPRSIHG 52 >EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglucosaminidase FDL protein. Length = 630 Score = 20.6 bits (41), Expect = 6.6 Identities = 7/16 (43%), Positives = 8/16 (50%) Frame = -2 Query: 210 CKSESPW*APVGSMPC 163 C +E PW G PC Sbjct: 351 CVNERPWSLYCGEPPC 366 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 20.6 bits (41), Expect = 6.6 Identities = 11/34 (32%), Positives = 15/34 (44%) Frame = +2 Query: 143 WEIICDEHGIDPTGAYHGDSDLQLERINVYYNEA 244 W + D G AYHGD + E I ++A Sbjct: 918 WIVNRDTSGATGPFAYHGDQWVGFEDIKSVRDKA 951 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 86,858 Number of Sequences: 336 Number of extensions: 1612 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 9460170 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -