SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= epV32043
         (430 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ439353-6|CAD27928.1|  695|Anopheles gambiae putative G-protein...    29   0.053
AY183375-1|AAO24765.1|  679|Anopheles gambiae NADPH cytochrome P...    27   0.28 
EF426194-1|ABO26437.1|  133|Anopheles gambiae unknown protein.         23   4.6  
EF426193-1|ABO26436.1|  133|Anopheles gambiae unknown protein.         23   4.6  
EF426192-1|ABO26435.1|  133|Anopheles gambiae unknown protein.         23   4.6  
EF426191-1|ABO26434.1|  133|Anopheles gambiae unknown protein.         23   4.6  
EF426190-1|ABO26433.1|  133|Anopheles gambiae unknown protein.         23   4.6  
EF426189-1|ABO26432.1|  133|Anopheles gambiae unknown protein.         23   4.6  
EF426188-1|ABO26431.1|  133|Anopheles gambiae unknown protein.         23   4.6  
EF426187-1|ABO26430.1|  133|Anopheles gambiae unknown protein.         23   4.6  
EF426186-1|ABO26429.1|  133|Anopheles gambiae unknown protein.         23   4.6  
EF426185-1|ABO26428.1|  133|Anopheles gambiae unknown protein.         23   4.6  
EF426184-1|ABO26427.1|  133|Anopheles gambiae unknown protein.         23   4.6  
EF426183-1|ABO26426.1|  133|Anopheles gambiae unknown protein.         23   4.6  
EF426182-1|ABO26425.1|  133|Anopheles gambiae unknown protein.         23   4.6  
EF426181-1|ABO26424.1|  133|Anopheles gambiae unknown protein.         23   4.6  
EF426180-1|ABO26423.1|  133|Anopheles gambiae unknown protein.         23   4.6  
EF426179-1|ABO26422.1|  133|Anopheles gambiae unknown protein.         23   4.6  
AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-sign...    23   6.1  
AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr...    22   8.0  
AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22...    22   8.0  

>AJ439353-6|CAD27928.1|  695|Anopheles gambiae putative G-protein
           coupled receptor protein.
          Length = 695

 Score = 29.5 bits (63), Expect = 0.053
 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 2/44 (4%)
 Frame = -2

Query: 126 LVAALTSLXYVRFPSFCFIY--VNYKLLNTKNTATARYHYTVAY 1
           L+A L    ++    +CFIY  V Y L+  + T   +YHY + Y
Sbjct: 254 LIALLLHYLHLSTSIWCFIYIYVIYDLIANECTPKLKYHYLMGY 297


>AY183375-1|AAO24765.1|  679|Anopheles gambiae NADPH cytochrome P450
           reductase protein.
          Length = 679

 Score = 27.1 bits (57), Expect = 0.28
 Identities = 9/16 (56%), Positives = 11/16 (68%)
 Frame = +2

Query: 137 KFWEIICDEHGIDPTG 184
           KFW  +CD  GI+ TG
Sbjct: 225 KFWPTVCDYFGIESTG 240


>EF426194-1|ABO26437.1|  133|Anopheles gambiae unknown protein.
          Length = 133

 Score = 23.0 bits (47), Expect = 4.6
 Identities = 5/10 (50%), Positives = 7/10 (70%)
 Frame = -3

Query: 401 CSVPWPSCCR 372
           C+ PW  CC+
Sbjct: 66  CNTPWADCCK 75


>EF426193-1|ABO26436.1|  133|Anopheles gambiae unknown protein.
          Length = 133

 Score = 23.0 bits (47), Expect = 4.6
 Identities = 5/10 (50%), Positives = 7/10 (70%)
 Frame = -3

Query: 401 CSVPWPSCCR 372
           C+ PW  CC+
Sbjct: 66  CNTPWADCCK 75


>EF426192-1|ABO26435.1|  133|Anopheles gambiae unknown protein.
          Length = 133

 Score = 23.0 bits (47), Expect = 4.6
 Identities = 5/10 (50%), Positives = 7/10 (70%)
 Frame = -3

Query: 401 CSVPWPSCCR 372
           C+ PW  CC+
Sbjct: 66  CNTPWADCCK 75


>EF426191-1|ABO26434.1|  133|Anopheles gambiae unknown protein.
          Length = 133

 Score = 23.0 bits (47), Expect = 4.6
 Identities = 5/10 (50%), Positives = 7/10 (70%)
 Frame = -3

Query: 401 CSVPWPSCCR 372
           C+ PW  CC+
Sbjct: 66  CNTPWADCCK 75


>EF426190-1|ABO26433.1|  133|Anopheles gambiae unknown protein.
          Length = 133

 Score = 23.0 bits (47), Expect = 4.6
 Identities = 5/10 (50%), Positives = 7/10 (70%)
 Frame = -3

Query: 401 CSVPWPSCCR 372
           C+ PW  CC+
Sbjct: 66  CNTPWADCCK 75


>EF426189-1|ABO26432.1|  133|Anopheles gambiae unknown protein.
          Length = 133

 Score = 23.0 bits (47), Expect = 4.6
 Identities = 5/10 (50%), Positives = 7/10 (70%)
 Frame = -3

Query: 401 CSVPWPSCCR 372
           C+ PW  CC+
Sbjct: 66  CNTPWADCCK 75


>EF426188-1|ABO26431.1|  133|Anopheles gambiae unknown protein.
          Length = 133

 Score = 23.0 bits (47), Expect = 4.6
 Identities = 5/10 (50%), Positives = 7/10 (70%)
 Frame = -3

Query: 401 CSVPWPSCCR 372
           C+ PW  CC+
Sbjct: 66  CNTPWADCCK 75


>EF426187-1|ABO26430.1|  133|Anopheles gambiae unknown protein.
          Length = 133

 Score = 23.0 bits (47), Expect = 4.6
 Identities = 5/10 (50%), Positives = 7/10 (70%)
 Frame = -3

Query: 401 CSVPWPSCCR 372
           C+ PW  CC+
Sbjct: 66  CNTPWADCCK 75


>EF426186-1|ABO26429.1|  133|Anopheles gambiae unknown protein.
          Length = 133

 Score = 23.0 bits (47), Expect = 4.6
 Identities = 5/10 (50%), Positives = 7/10 (70%)
 Frame = -3

Query: 401 CSVPWPSCCR 372
           C+ PW  CC+
Sbjct: 66  CNTPWADCCK 75


>EF426185-1|ABO26428.1|  133|Anopheles gambiae unknown protein.
          Length = 133

 Score = 23.0 bits (47), Expect = 4.6
 Identities = 5/10 (50%), Positives = 7/10 (70%)
 Frame = -3

Query: 401 CSVPWPSCCR 372
           C+ PW  CC+
Sbjct: 66  CNTPWADCCK 75


>EF426184-1|ABO26427.1|  133|Anopheles gambiae unknown protein.
          Length = 133

 Score = 23.0 bits (47), Expect = 4.6
 Identities = 5/10 (50%), Positives = 7/10 (70%)
 Frame = -3

Query: 401 CSVPWPSCCR 372
           C+ PW  CC+
Sbjct: 66  CNTPWADCCK 75


>EF426183-1|ABO26426.1|  133|Anopheles gambiae unknown protein.
          Length = 133

 Score = 23.0 bits (47), Expect = 4.6
 Identities = 5/10 (50%), Positives = 7/10 (70%)
 Frame = -3

Query: 401 CSVPWPSCCR 372
           C+ PW  CC+
Sbjct: 66  CNTPWADCCK 75


>EF426182-1|ABO26425.1|  133|Anopheles gambiae unknown protein.
          Length = 133

 Score = 23.0 bits (47), Expect = 4.6
 Identities = 5/10 (50%), Positives = 7/10 (70%)
 Frame = -3

Query: 401 CSVPWPSCCR 372
           C+ PW  CC+
Sbjct: 66  CNTPWADCCK 75


>EF426181-1|ABO26424.1|  133|Anopheles gambiae unknown protein.
          Length = 133

 Score = 23.0 bits (47), Expect = 4.6
 Identities = 5/10 (50%), Positives = 7/10 (70%)
 Frame = -3

Query: 401 CSVPWPSCCR 372
           C+ PW  CC+
Sbjct: 66  CNTPWADCCK 75


>EF426180-1|ABO26423.1|  133|Anopheles gambiae unknown protein.
          Length = 133

 Score = 23.0 bits (47), Expect = 4.6
 Identities = 5/10 (50%), Positives = 7/10 (70%)
 Frame = -3

Query: 401 CSVPWPSCCR 372
           C+ PW  CC+
Sbjct: 66  CNTPWADCCK 75


>EF426179-1|ABO26422.1|  133|Anopheles gambiae unknown protein.
          Length = 133

 Score = 23.0 bits (47), Expect = 4.6
 Identities = 5/10 (50%), Positives = 7/10 (70%)
 Frame = -3

Query: 401 CSVPWPSCCR 372
           C+ PW  CC+
Sbjct: 66  CNTPWADCCK 75


>AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-signaling
            promoter protein.
          Length = 1197

 Score = 22.6 bits (46), Expect = 6.1
 Identities = 11/22 (50%), Positives = 12/22 (54%)
 Frame = -2

Query: 351  KLSXRKICPKGPERTESMVPGS 286
            +LS  K  PKG E    MVP S
Sbjct: 1036 RLSHSKSWPKGTENENYMVPPS 1057


>AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine
           protease protein.
          Length = 1322

 Score = 22.2 bits (45), Expect = 8.0
 Identities = 7/12 (58%), Positives = 11/12 (91%)
 Frame = -3

Query: 38  ILLPHATTTLSP 3
           +++PHATTT +P
Sbjct: 702 LIVPHATTTKTP 713


>AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D
           protein.
          Length = 1322

 Score = 22.2 bits (45), Expect = 8.0
 Identities = 7/12 (58%), Positives = 11/12 (91%)
 Frame = -3

Query: 38  ILLPHATTTLSP 3
           +++PHATTT +P
Sbjct: 701 LIVPHATTTKTP 712


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 399,276
Number of Sequences: 2352
Number of extensions: 6956
Number of successful extensions: 27
Number of sequences better than 10.0: 21
Number of HSP's better than 10.0 without gapping: 27
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 27
length of database: 563,979
effective HSP length: 59
effective length of database: 425,211
effective search space used: 35292513
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -