BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32040 (516 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein p... 25 0.61 DQ855483-1|ABH88170.1| 117|Apis mellifera chemosensory protein ... 23 1.9 AJ973398-1|CAJ01445.1| 117|Apis mellifera hypothetical protein ... 23 1.9 DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated... 21 7.5 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 21 7.5 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 21 7.5 DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 21 10.0 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 21 10.0 >DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein protein. Length = 430 Score = 24.6 bits (51), Expect = 0.61 Identities = 21/70 (30%), Positives = 32/70 (45%) Frame = +1 Query: 145 VLRDGVILCKLANKLAPGSVKKIQERGTNFQLMENIQRFQAAIKKYGVPEEEIFQTADLF 324 + R+ V+L L L SV IQ+ GT F ++RF Y P +E +T + Sbjct: 1 MFREFVLLASLLY-LGNESVHGIQKWGTQFGQAPLLERFFWRTLDYAYP-DEASKTMAMM 58 Query: 325 ERRNIPQVTL 354 + IP+ L Sbjct: 59 KGEYIPENAL 68 >DQ855483-1|ABH88170.1| 117|Apis mellifera chemosensory protein 2 protein. Length = 117 Score = 23.0 bits (47), Expect = 1.9 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +1 Query: 40 ACTQCLPETRDQEQEVLTWI 99 AC QC PE Q ++VL+ I Sbjct: 79 ACPQCSPEETRQIKKVLSHI 98 >AJ973398-1|CAJ01445.1| 117|Apis mellifera hypothetical protein protein. Length = 117 Score = 23.0 bits (47), Expect = 1.9 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +1 Query: 40 ACTQCLPETRDQEQEVLTWI 99 AC QC PE Q ++VL+ I Sbjct: 79 ACPQCSPEETRQIKKVLSHI 98 >DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 510 Score = 21.0 bits (42), Expect = 7.5 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +3 Query: 219 ERNQLPAHGE 248 E NQLP HG+ Sbjct: 49 ENNQLPTHGK 58 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.0 bits (42), Expect = 7.5 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +1 Query: 151 RDGVILCKLANKLAPGSVKKIQ 216 R+G LC+ +N + G K +Q Sbjct: 780 REGFYLCQASNGIGSGIGKVVQ 801 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.0 bits (42), Expect = 7.5 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +1 Query: 151 RDGVILCKLANKLAPGSVKKIQ 216 R+G LC+ +N + G K +Q Sbjct: 776 REGFYLCQASNGIGSGIGKVVQ 797 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 20.6 bits (41), Expect = 10.0 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = +1 Query: 403 GPQLGPKMADKNERTFTEE 459 GP+ GPK+ +K + +E Sbjct: 203 GPEKGPKVPEKKKEDEIDE 221 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 20.6 bits (41), Expect = 10.0 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 448 FTEEQLRAHNAELNLQMGFN 507 FT+++ + ELNLQ FN Sbjct: 17 FTKQKKVKEDTELNLQTIFN 36 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 164,303 Number of Sequences: 438 Number of extensions: 3788 Number of successful extensions: 8 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14354847 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -