BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32039 (516 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 ... 23 1.6 AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 ... 23 1.6 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 23 2.1 AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 22 3.7 >AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 505 Score = 23.0 bits (47), Expect = 1.6 Identities = 8/30 (26%), Positives = 15/30 (50%) Frame = -2 Query: 437 LLISSLFNGCYYTYKPSYLITLSIKKKTHQ 348 LL L + C Y + P Y + + ++ H+ Sbjct: 221 LLRCWLISKCIYVFNPRYYLEKKVTRRLHR 250 >AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q7 protein. Length = 505 Score = 23.0 bits (47), Expect = 1.6 Identities = 8/30 (26%), Positives = 15/30 (50%) Frame = -2 Query: 437 LLISSLFNGCYYTYKPSYLITLSIKKKTHQ 348 LL L + C Y + P Y + + ++ H+ Sbjct: 221 LLRCWLISKCIYVFNPRYYLEKKVTRRLHR 250 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 22.6 bits (46), Expect = 2.1 Identities = 14/45 (31%), Positives = 25/45 (55%), Gaps = 2/45 (4%) Frame = +3 Query: 9 INFIIVFLKITPL--LINV*MTSMCPSILAITSFKWKHC*PCGLM 137 I FI L +P+ +I V +TS+C ++ + S ++ CG+M Sbjct: 489 IYFISKTLAESPIFIIIPVTLTSVCYFMIGLNSHGFRFYIACGIM 533 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 21.8 bits (44), Expect = 3.7 Identities = 14/45 (31%), Positives = 25/45 (55%), Gaps = 2/45 (4%) Frame = +3 Query: 9 INFIIVFLKITPL--LINV*MTSMCPSILAITSFKWKHC*PCGLM 137 I FI L +P+ +I V +TS+C ++ + S ++ CG+M Sbjct: 489 IYFISKTLAESPIFIIIPVILTSVCYFMIGLNSQGFRFYIACGIM 533 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 120,086 Number of Sequences: 336 Number of extensions: 2589 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12363686 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -