BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32036 (310 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A1XDB3 Cluster: STIP; n=1; Bombyx mori|Rep: STIP - Bomb... 38 0.033 UniRef50_Q5WMQ0 Cluster: Putative uncharacterized protein OSJNBa... 32 2.9 UniRef50_Q871Y1 Cluster: Putative uncharacterized protein B9K17.... 31 6.6 UniRef50_Q6CPZ5 Cluster: Kluyveromyces lactis strain NRRL Y-1140... 30 8.8 >UniRef50_A1XDB3 Cluster: STIP; n=1; Bombyx mori|Rep: STIP - Bombyx mori (Silk moth) Length = 782 Score = 38.3 bits (85), Expect = 0.033 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = +1 Query: 163 AGWWYLPVRTHKRPYHQ 213 A WWYLP RTHKR YH+ Sbjct: 569 AEWWYLPARTHKRSYHR 585 >UniRef50_Q5WMQ0 Cluster: Putative uncharacterized protein OSJNBa0053E01.2; n=1; Oryza sativa (japonica cultivar-group)|Rep: Putative uncharacterized protein OSJNBa0053E01.2 - Oryza sativa subsp. japonica (Rice) Length = 536 Score = 31.9 bits (69), Expect = 2.9 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +2 Query: 68 QKSKKDLQRYNSYNGWPHPSNKNALLLYGRNXQGGGTYP 184 +K +K+L + N+ P+PSNK + GR GGG P Sbjct: 279 RKERKNLCQPNNQTPAPYPSNKQPRIRGGRRAVGGGRKP 317 >UniRef50_Q871Y1 Cluster: Putative uncharacterized protein B9K17.090; n=2; Sordariales|Rep: Putative uncharacterized protein B9K17.090 - Neurospora crassa Length = 538 Score = 30.7 bits (66), Expect = 6.6 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +2 Query: 80 KDLQRYNSYNGWPHPSNKNALLLYGRNXQGGG 175 ++LQ N+ GWPHP ++A G GGG Sbjct: 260 RELQSRNAGQGWPHPKTRHA----GHGGSGGG 287 >UniRef50_Q6CPZ5 Cluster: Kluyveromyces lactis strain NRRL Y-1140 chromosome E of strain NRRL Y- 1140 of Kluyveromyces lactis; n=1; Kluyveromyces lactis|Rep: Kluyveromyces lactis strain NRRL Y-1140 chromosome E of strain NRRL Y- 1140 of Kluyveromyces lactis - Kluyveromyces lactis (Yeast) (Candida sphaerica) Length = 774 Score = 30.3 bits (65), Expect = 8.8 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = +2 Query: 56 TFVLQKSKKDLQRYNSYNG 112 +FV Q SK DL YNS+NG Sbjct: 649 SFVSQSSKNDLSNYNSFNG 667 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 273,639,218 Number of Sequences: 1657284 Number of extensions: 4650543 Number of successful extensions: 8731 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8558 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8731 length of database: 575,637,011 effective HSP length: 79 effective length of database: 444,711,575 effective search space used: 10228366225 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -