BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32033 (516 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle pr... 24 0.70 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 4.9 EF125547-1|ABL73931.1| 255|Tribolium castaneum obstractor D pro... 21 6.5 DQ855501-1|ABH88188.1| 146|Tribolium castaneum chemosensory pro... 21 8.6 >AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle protein. Length = 361 Score = 24.2 bits (50), Expect = 0.70 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = +3 Query: 90 YFYSHLSNLLPT 125 YFYSHLSN P+ Sbjct: 248 YFYSHLSNPYPS 259 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.4 bits (43), Expect = 4.9 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +3 Query: 60 EKKNVHKAPLYFY 98 +K+ H APLY+Y Sbjct: 2520 DKQTGHVAPLYYY 2532 >EF125547-1|ABL73931.1| 255|Tribolium castaneum obstractor D protein. Length = 255 Score = 21.0 bits (42), Expect = 6.5 Identities = 9/34 (26%), Positives = 15/34 (44%) Frame = +3 Query: 96 YSHLSNLLPTXIINQAII*CVYHDNKDCSVKSTL 197 Y L + ++ + CV +DC V ST+ Sbjct: 180 YPRLQRCPAMLVFDRRSLRCVVPPTEDCDVPSTI 213 >DQ855501-1|ABH88188.1| 146|Tribolium castaneum chemosensory protein 15 protein. Length = 146 Score = 20.6 bits (41), Expect = 8.6 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = +3 Query: 51 ERKEKKNVHKAPLYFYSHLSN 113 E+K+K++VHK + H N Sbjct: 74 EQKQKEDVHKVFQHLMIHRPN 94 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 102,239 Number of Sequences: 336 Number of extensions: 1933 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12363686 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -