BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32033 (516 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z83104-3|CAB05476.1| 295|Caenorhabditis elegans Hypothetical pr... 28 4.6 U93842-1|AAB52421.1| 1409|Caenorhabditis elegans regulator of pr... 27 8.0 U49945-3|AAM51509.1| 1408|Caenorhabditis elegans Aboc, expulsion... 27 8.0 U49945-2|AAC47926.1| 1409|Caenorhabditis elegans Aboc, expulsion... 27 8.0 >Z83104-3|CAB05476.1| 295|Caenorhabditis elegans Hypothetical protein F09B12.2 protein. Length = 295 Score = 27.9 bits (59), Expect = 4.6 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = +1 Query: 82 HHFTFTAICLTFYLQX*LIRLLFNVFIMIIKI 177 HH +F A+C+ + Q + + N+FIM + + Sbjct: 131 HHCSFGAVCVGHFNQRYFVAAVINLFIMTLPL 162 >U93842-1|AAB52421.1| 1409|Caenorhabditis elegans regulator of presynaptic activity protein. Length = 1409 Score = 27.1 bits (57), Expect = 8.0 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = +1 Query: 427 PVPNSPYSEXYYNSLAVVLQRRDWEN 504 P PN P Y L + +Q + W+N Sbjct: 1064 PTPNEPVRHYIYQELILAVQHQIWQN 1089 >U49945-3|AAM51509.1| 1408|Caenorhabditis elegans Aboc, expulsion defective protein3, isoform b protein. Length = 1408 Score = 27.1 bits (57), Expect = 8.0 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = +1 Query: 427 PVPNSPYSEXYYNSLAVVLQRRDWEN 504 P PN P Y L + +Q + W+N Sbjct: 1064 PTPNEPVRHYIYQELILAVQHQIWQN 1089 >U49945-2|AAC47926.1| 1409|Caenorhabditis elegans Aboc, expulsion defective protein3, isoform a protein. Length = 1409 Score = 27.1 bits (57), Expect = 8.0 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = +1 Query: 427 PVPNSPYSEXYYNSLAVVLQRRDWEN 504 P PN P Y L + +Q + W+N Sbjct: 1064 PTPNEPVRHYIYQELILAVQHQIWQN 1089 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,488,326 Number of Sequences: 27780 Number of extensions: 159798 Number of successful extensions: 279 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 276 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 279 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 996506972 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -