BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32028 (516 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-12|CAD27934.1| 160|Anopheles gambiae putative MLC1 pro... 44 3e-06 AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcript... 25 2.0 AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylch... 23 4.6 AJ535207-1|CAD59407.1| 1036|Anopheles gambiae SMC5 protein protein. 23 4.6 >AJ439353-12|CAD27934.1| 160|Anopheles gambiae putative MLC1 protein protein. Length = 160 Score = 44.0 bits (99), Expect = 3e-06 Identities = 33/137 (24%), Positives = 61/137 (44%), Gaps = 4/137 (2%) Frame = +2 Query: 98 FQMFDTTKSGYIDVLKISTILNTMGQLFDDSXLQALIDENDPENSGKINFDGFCNIASHF 277 F ++D SG +D + + L + L L + KI F+ F I S Sbjct: 17 FSVYDWEGSGQMDAMDLGNALRALN-LNPTIELIGKMGGTQKRGEKKIKFEEFLPIFSQV 75 Query: 278 LEEEDAEAMQQELKEAFRLYDREGXGYITTSTLKEILAALDDKLSNADLDGIIAEI---- 445 +E++ + L E +LYD+ G + + L L AL ++L + +LD ++ + Sbjct: 76 KKEKEQGCFEDFL-ECLKLYDKNEDGTMLLAELTHSLTALGERLDDVELDNVMKDCMDPE 134 Query: 446 DTDGS*TVDFDEFMEMM 496 D DG+ + + F++ M Sbjct: 135 DDDGN--IPYAPFLKKM 149 >AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcriptase protein. Length = 1222 Score = 24.6 bits (51), Expect = 2.0 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = +1 Query: 70 QKDGHAA*SIPDV*HHEVWLHRRAEDLH 153 Q+ AA + P + VW HR DLH Sbjct: 884 QRAWDAAAAAPTASRYAVWAHRMIPDLH 911 >AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 3 protein. Length = 710 Score = 23.4 bits (48), Expect = 4.6 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +2 Query: 248 DGFCNIASHFLEEEDAEAMQQELKEAFRLYDR 343 DG IA H +EE++ ++++ K + DR Sbjct: 627 DGVTYIADHTRKEEESSRVKEDWKYVAMVLDR 658 >AJ535207-1|CAD59407.1| 1036|Anopheles gambiae SMC5 protein protein. Length = 1036 Score = 23.4 bits (48), Expect = 4.6 Identities = 14/49 (28%), Positives = 22/49 (44%) Frame = +2 Query: 269 SHFLEEEDAEAMQQELKEAFRLYDREGXGYITTSTLKEILAALDDKLSN 415 SHF+ + +++ R YD G +E L+ALD KL + Sbjct: 891 SHFMSSMGFAGEVELIRQGERDYDEYGIRIYVKYRNEEKLSALDRKLQS 939 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 483,223 Number of Sequences: 2352 Number of extensions: 8569 Number of successful extensions: 14 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46937349 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -