BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32026 (516 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC32A11.01 |mug8||conserved fungal protein|Schizosaccharomyces... 25 5.1 SPCC4G3.14 |mdj1||DNAJ domain protein Mdj1 |Schizosaccharomyces ... 25 5.1 SPCC1235.09 |||histone deacetylase complex subunit|Schizosacchar... 25 5.1 SPBC32F12.01c ||SPBC685.10c|inositol phosphosphingolipid phospho... 25 6.7 >SPAC32A11.01 |mug8||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 720 Score = 25.4 bits (53), Expect = 5.1 Identities = 13/56 (23%), Positives = 25/56 (44%), Gaps = 1/56 (1%) Frame = +1 Query: 121 QKKILSXFQDVSQLNTXDEYYKIGKDY-DIEMNMDNYTNKKAVEEFLKMYRTGFMP 285 + K+ D + L D KD+ ++ +N +Y NK ++ F + + F P Sbjct: 617 EMKLSDKIDDANSLKDDDFIQGSKKDFFEMNLNHSSYQNKDELKPFQLLVKHAFKP 672 >SPCC4G3.14 |mdj1||DNAJ domain protein Mdj1 |Schizosaccharomyces pombe|chr 3|||Manual Length = 528 Score = 25.4 bits (53), Expect = 5.1 Identities = 13/41 (31%), Positives = 16/41 (39%) Frame = +1 Query: 127 KILSXFQDVSQLNTXDEYYKIGKDYDIEMNMDNYTNKKAVE 249 K L + S YYK+ K Y + N D K VE Sbjct: 89 KTLGVSKSASASEIKSAYYKLAKQYHPDANPDKAAQDKFVE 129 >SPCC1235.09 |||histone deacetylase complex subunit|Schizosaccharomyces pombe|chr 3|||Manual Length = 564 Score = 25.4 bits (53), Expect = 5.1 Identities = 12/22 (54%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +1 Query: 415 NQGQFL-YAFYIAVIQRSDCHG 477 N G FL YAF+ VI+ D HG Sbjct: 274 NSGSFLAYAFFSGVIEIYDSHG 295 >SPBC32F12.01c ||SPBC685.10c|inositol phosphosphingolipid phospholipase C |Schizosaccharomyces pombe|chr 2|||Manual Length = 424 Score = 25.0 bits (52), Expect = 6.7 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 73 PSTIKTKNVDAVFVEKQKKILSXFQDVSQLNT 168 PST + KN VF+E+ K+ + D + T Sbjct: 263 PSTCEAKNAKVVFLERVPKLDCSYSDHFAIET 294 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,035,283 Number of Sequences: 5004 Number of extensions: 37394 Number of successful extensions: 101 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 99 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 101 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 208287218 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -