BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32026 (516 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_1025 - 10506144-10506226,10506643-10506699,10507502-105076... 32 0.31 03_02_0186 - 6243487-6243799,6243892-6244400,6244495-6244557,624... 29 2.9 01_06_0006 - 25517892-25517935,25518156-25518276,25518598-255187... 28 3.9 05_01_0155 + 1043045-1043240,1043325-1043401,1043963-1044092,104... 28 5.1 10_08_0188 - 15596062-15597084,15597513-15597791 27 6.8 04_03_0664 + 18501248-18502802,18503370-18505054 27 6.8 >12_01_1025 - 10506144-10506226,10506643-10506699,10507502-10507605, 10507884-10507937,10508107-10508193,10509027-10509214, 10509793-10509854,10510084-10510354,10510756-10510834, 10511715-10511913,10512816-10512960,10513324-10513416, 10514449-10514736 Length = 569 Score = 31.9 bits (69), Expect = 0.31 Identities = 17/37 (45%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Frame = +1 Query: 373 ETFYXTACFARVHLNQGQFLYAF-YIAVIQRSDCHGF 480 ETF+ TAC R HL QG+ + A+ Y+ + DC GF Sbjct: 427 ETFFTTACMGRGHLCQGKLVDAYRYLHKEKDMDC-GF 462 >03_02_0186 - 6243487-6243799,6243892-6244400,6244495-6244557, 6245482-6245681,6246125-6246519,6246776-6246888 Length = 530 Score = 28.7 bits (61), Expect = 2.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +3 Query: 390 CLFCACASQSRSILVCLLHRCYPA 461 CLFC SR ILVC L RC A Sbjct: 58 CLFCEANFISRRILVCDLLRCLVA 81 >01_06_0006 - 25517892-25517935,25518156-25518276,25518598-25518733, 25519189-25519280,25519358-25519426,25519710-25519821, 25519897-25520015,25520302-25520355,25520811-25520891, 25520968-25521051,25521124-25521315,25521633-25521746, 25521832-25521978,25522066-25522302,25522762-25522810, 25522894-25523027,25523124-25523324,25523532-25523701, 25523773-25523875,25524198-25524361,25525015-25525055, 25525144-25525187 Length = 835 Score = 28.3 bits (60), Expect = 3.9 Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 4/47 (8%) Frame = +1 Query: 208 EMNMDNYTNKKAVEEFLKMYRTGF----MPKNLEFSVFYDKMRDEAI 336 E + Y NK +EFLK+ GF + K LE D M + A+ Sbjct: 695 ERDFRRYINKLGYKEFLKLPEMGFGTSLLQKRLEIETMTDNMSELAV 741 >05_01_0155 + 1043045-1043240,1043325-1043401,1043963-1044092, 1044376-1044473,1045622-1045729,1045748-1045800, 1046876-1047080 Length = 288 Score = 27.9 bits (59), Expect = 5.1 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -2 Query: 509 GYTSHGAGTTKPWQSE 462 G+TSHG G T WQS+ Sbjct: 243 GWTSHGGGRTGNWQSQ 258 >10_08_0188 - 15596062-15597084,15597513-15597791 Length = 433 Score = 27.5 bits (58), Expect = 6.8 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = +3 Query: 33 WACSRRAQQCSTKAEHHKDKKCG 101 W C RR +Q ++ ++H D+K G Sbjct: 206 WHCQRRVRQPNSLCDYHSDQKRG 228 >04_03_0664 + 18501248-18502802,18503370-18505054 Length = 1079 Score = 27.5 bits (58), Expect = 6.8 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -1 Query: 105 GIHIFCLYGARLWYCTAEHDGYKPSQNPRQTS 10 G+ F L RL CT+ H ++ NPR+TS Sbjct: 145 GVERFVLLVDRLDSCTSRHVCHQEVSNPRETS 176 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,739,802 Number of Sequences: 37544 Number of extensions: 219245 Number of successful extensions: 496 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 493 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 496 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1118831240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -