BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32025 (516 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC19G7.14c |cog5||Golgi transport complex subunit Cog5 |Schizo... 26 3.8 SPAC5H10.04 |||NADPH dehydrogenase |Schizosaccharomyces pombe|ch... 25 5.1 SPCC1442.07c |||ubiquitin/metalloprotease fusion protein|Schizos... 25 6.7 SPCC736.12c |||conserved protein|Schizosaccharomyces pombe|chr 3... 25 6.7 >SPBC19G7.14c |cog5||Golgi transport complex subunit Cog5 |Schizosaccharomyces pombe|chr 2|||Manual Length = 411 Score = 25.8 bits (54), Expect = 3.8 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = -2 Query: 104 LYWKGVYFPVSAASATVRDRQIAKKTRISRCYEA 3 LYW G +F + A + I + ++SR Y+A Sbjct: 126 LYWLGEFFGIQAKLFPLFQGSINENEKLSRYYQA 159 >SPAC5H10.04 |||NADPH dehydrogenase |Schizosaccharomyces pombe|chr 1|||Manual Length = 382 Score = 25.4 bits (53), Expect = 5.1 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = -1 Query: 117 RVNSVVLERSVLSSFGGQRHCQRQADCQKDTHFPL 13 +VN +L+R VL FG Q + + + FPL Sbjct: 190 QVNGFLLDRFVLGGFGDQCDPEYRGSIENRCRFPL 224 >SPCC1442.07c |||ubiquitin/metalloprotease fusion protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 282 Score = 25.0 bits (52), Expect = 6.7 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +1 Query: 142 PGRYVADPXRYDPSRDN 192 PG YV+D Y P +DN Sbjct: 236 PGSYVSDRASYTPQQDN 252 >SPCC736.12c |||conserved protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 437 Score = 25.0 bits (52), Expect = 6.7 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +1 Query: 319 KEDLSKYLGDAYKGSSIVPLPVVKPTISRASHTHI 423 K+D SK + DAYK +S+ + V + T + + + Sbjct: 375 KKDSSKRISDAYKKASVYFIFVAQQTYNALGYAQV 409 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,665,536 Number of Sequences: 5004 Number of extensions: 26479 Number of successful extensions: 68 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 66 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 68 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 208287218 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -