BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32025 (516 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ224421-1|ABB53378.1| 352|Homo sapiens killer immunoglobulin-l... 29 7.3 BC011013-1|AAH11013.1| 127|Homo sapiens CENPA protein protein. 29 9.7 >DQ224421-1|ABB53378.1| 352|Homo sapiens killer immunoglobulin-like receptor KIR3DL0 protein. Length = 352 Score = 29.5 bits (63), Expect = 7.3 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = -1 Query: 483 PLGGTTLLATYVGVTXLLATYVGVTGTGNGRLHDGQGNN 367 PLGG L+ + + ++ T TGT + LH G NN Sbjct: 40 PLGGRVTLSCHSHLRFVIWTIFQTTGTRSHELHTGLSNN 78 >BC011013-1|AAH11013.1| 127|Homo sapiens CENPA protein protein. Length = 127 Score = 29.1 bits (62), Expect = 9.7 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +1 Query: 349 AYKGSSIVPLPVVKPTISRASHTHIRCQQGGXTHIR 456 ++ GS ++P P + S +SH H R +QG IR Sbjct: 30 SWPGSCLLPAPSTRSRQSASSHQHSRRRQGWLKEIR 65 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 64,480,413 Number of Sequences: 237096 Number of extensions: 1139585 Number of successful extensions: 3756 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3610 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3722 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4876707572 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -