BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32020 (323 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 23 2.9 AY028785-1|AAK32959.1| 509|Anopheles gambiae cytochrome P450 pr... 21 8.8 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 23.0 bits (47), Expect = 2.9 Identities = 11/37 (29%), Positives = 17/37 (45%) Frame = -1 Query: 218 WDRRK*DGFLSSTDDVGSFRGSWLSLQVDGTCRQPWL 108 W+ + D F + G ++LQ +GTC WL Sbjct: 744 WELKHADCFNHCLEVYRPSSGGAVALQSNGTCASLWL 780 >AY028785-1|AAK32959.1| 509|Anopheles gambiae cytochrome P450 protein. Length = 509 Score = 21.4 bits (43), Expect = 8.8 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +2 Query: 248 IFLRTKKKKKNSRGGPVPNSP 310 +FLR+K SRG P SP Sbjct: 20 LFLRSKHNYWRSRGFPCKPSP 40 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 302,923 Number of Sequences: 2352 Number of extensions: 4745 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 563,979 effective HSP length: 56 effective length of database: 432,267 effective search space used: 22045617 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -