BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32016 (314 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC162.02c |||AMP-binding dehydrogenase |Schizosaccharomyces po... 25 2.7 SPBC30D10.06 |lsm4||U6 snRNP-associated protein Lsm4|Schizosacch... 24 4.7 SPAC144.10c |gwt1|mug59|pig-W|Schizosaccharomyces pombe|chr 1|||... 24 6.3 >SPCC162.02c |||AMP-binding dehydrogenase |Schizosaccharomyces pombe|chr 3|||Manual Length = 981 Score = 25.0 bits (52), Expect = 2.7 Identities = 19/58 (32%), Positives = 25/58 (43%), Gaps = 2/58 (3%) Frame = +3 Query: 57 VRVLNATVSTLYLVIP--EN*TSNLTPSILM*FIVKFYINLISFLFLLYTRDRCGSQR 224 VR +A S +L P N SN TP+ + I K N+ S + L D C R Sbjct: 575 VRFFHAIQSHFHLEGPIRYNMNSNCTPNSIASIIQKKSYNVSSITYELLNEDACALSR 632 >SPBC30D10.06 |lsm4||U6 snRNP-associated protein Lsm4|Schizosaccharomyces pombe|chr 2|||Manual Length = 121 Score = 24.2 bits (50), Expect = 4.7 Identities = 12/23 (52%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 78 RLRSELGRAQH-HTAPGSRGRPR 13 R R + GR + HTAP RGR R Sbjct: 95 RGRGQRGRGNYGHTAPNRRGRGR 117 >SPAC144.10c |gwt1|mug59|pig-W|Schizosaccharomyces pombe|chr 1|||Manual Length = 459 Score = 23.8 bits (49), Expect = 6.3 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = +3 Query: 120 NLTPSILM*FIVKFYINLISFLFLLYTRDRCG 215 N+ P + F+V+F+I + LF++Y + G Sbjct: 43 NILPKGNLGFLVEFFIFCLIPLFVIYVSSKVG 74 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,080,824 Number of Sequences: 5004 Number of extensions: 15001 Number of successful extensions: 22 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 2,362,478 effective HSP length: 63 effective length of database: 2,047,226 effective search space used: 83936266 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -