BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32016 (314 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_07_0053 + 40772966-40773080,40773484-40773578,40773730-407738... 26 5.4 11_05_0035 - 18509505-18509615,18509840-18509950,18510318-185103... 26 7.1 05_04_0142 - 18372751-18373338 26 7.1 >01_07_0053 + 40772966-40773080,40773484-40773578,40773730-40773843, 40773984-40774088,40774179-40774250,40774293-40774346, 40774507-40774619,40774705-40774839,40774941-40775009, 40775140-40775227,40775327-40775398,40775476-40775576, 40775836-40775953,40776054-40776113,40776206-40776316, 40776499-40776573,40776821-40776854,40777453-40777805, 40778154-40778222,40778526-40778762 Length = 729 Score = 26.2 bits (55), Expect = 5.4 Identities = 13/39 (33%), Positives = 22/39 (56%) Frame = +3 Query: 69 NATVSTLYLVIPEN*TSNLTPSILM*FIVKFYINLISFL 185 N ++ + LV+PE +LTP + FIV I L++ + Sbjct: 310 NIPMADMELVLPEKKNPSLTPMDWVQFIVSVVIGLVTLV 348 >11_05_0035 - 18509505-18509615,18509840-18509950,18510318-18510377, 18510459-18510576,18510711-18510811,18510891-18510962, 18511069-18511156,18511423-18511557,18511655-18511767, 18511980-18512051,18512154-18512258,18512371-18512484, 18512587-18512681,18513539-18513686 Length = 480 Score = 25.8 bits (54), Expect = 7.1 Identities = 11/47 (23%), Positives = 25/47 (53%) Frame = +3 Query: 45 GVVLVRVLNATVSTLYLVIPEN*TSNLTPSILM*FIVKFYINLISFL 185 G+ + N ++ + LV+PE +LTP + F++ + L++ + Sbjct: 272 GIFVKHFKNIPMADMELVLPEKKNPSLTPMDWVKFLISAVLGLVTLI 318 >05_04_0142 - 18372751-18373338 Length = 195 Score = 25.8 bits (54), Expect = 7.1 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = +2 Query: 5 NSARGRPRDPGAVWCCARPSSE 70 ++A R P A WCC P E Sbjct: 127 DNAGAAARAPAAAWCCVCPDEE 148 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,781,229 Number of Sequences: 37544 Number of extensions: 106807 Number of successful extensions: 209 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 205 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 209 length of database: 14,793,348 effective HSP length: 72 effective length of database: 12,090,180 effective search space used: 386885760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -