BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32015 (516 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 22 3.7 DQ855490-1|ABH88177.1| 133|Tribolium castaneum chemosensory pro... 22 3.7 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 21.8 bits (44), Expect = 3.7 Identities = 8/26 (30%), Positives = 11/26 (42%) Frame = -1 Query: 93 PHDGTGRTQPSISVSAVPQPCGQLRP 16 P DGT +P + P+P P Sbjct: 73 PSDGTTSPEPDPEIPVAPEPAPLASP 98 >DQ855490-1|ABH88177.1| 133|Tribolium castaneum chemosensory protein 4 protein. Length = 133 Score = 21.8 bits (44), Expect = 3.7 Identities = 15/47 (31%), Positives = 23/47 (48%) Frame = +3 Query: 180 VVEAETKLKSEVTRIKKKLQIQITELELSLDVANKTNIDLQKTIKKQ 320 VV+ E LKS V + +K + LEL ++ + D K +KQ Sbjct: 38 VVKNERLLKSYVDCLLEKGRCSPDGLELKKNMPDAIETDCSKCSEKQ 84 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 88,953 Number of Sequences: 336 Number of extensions: 1394 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12363686 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -