BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32010 (516 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g11680.1 68414.m01341 obtusifoliol 14-demethylase (CYP51) ide... 28 3.2 At1g53600.1 68414.m06090 pentatricopeptide (PPR) repeat-containi... 27 7.5 >At1g11680.1 68414.m01341 obtusifoliol 14-demethylase (CYP51) identical to obtusifoliol 14-demethylase (GI:14624983) [Arabidopsis thaliana] Length = 488 Score = 28.3 bits (60), Expect = 3.2 Identities = 15/57 (26%), Positives = 24/57 (42%) Frame = +3 Query: 12 ALAAETGKYTPFQYNRVYSTVSPFVYKPGRYVADPGRYDPSRDNSGRYIPDNSGAYN 182 ++ A GK + +T F + DP YDP R + GR +GA++ Sbjct: 366 SVTARDGKTYDIPKGHIVATSPAFANRLPHIFKDPDTYDPERFSPGREEDKAAGAFS 422 >At1g53600.1 68414.m06090 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 839 Score = 27.1 bits (57), Expect = 7.5 Identities = 17/49 (34%), Positives = 19/49 (38%) Frame = -2 Query: 419 HLAGNVCGCDHLAGNVCGCDWHGNGRLHDGQGNNAGSLVSITKVFAEVL 273 H G CG H G GC G G G G + G + S V A L Sbjct: 781 HHGGGGCGGGHHGGGGGGCGGCGGGGC--GGGGDGGGMTSRAVVAASTL 827 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,826,275 Number of Sequences: 28952 Number of extensions: 146776 Number of successful extensions: 412 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 392 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 412 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 937669760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -