BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32004 (516 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g02640.2 68417.m00359 bZIP transcription factor family protei... 34 0.065 At4g02640.1 68417.m00358 bZIP transcription factor family protei... 34 0.065 At5g03660.1 68418.m00325 expressed protein low similarity to out... 30 1.1 At5g41790.1 68418.m05088 COP1-interactive protein 1 / CIP1 almos... 29 1.4 At4g02250.1 68417.m00304 invertase/pectin methylesterase inhibit... 29 1.4 At5g57970.1 68418.m07253 methyladenine glycosylase family protei... 28 3.2 At2g18900.1 68415.m02205 transducin family protein / WD-40 repea... 28 3.2 At5g57830.1 68418.m07232 expressed protein contains Pfam profile... 28 4.3 At1g79280.1 68414.m09242 expressed protein weak similarity to Nu... 28 4.3 At1g77550.1 68414.m09030 tubulin-tyrosine ligase family protein ... 28 4.3 At3g07790.1 68416.m00951 DGCR14-related similar to DGCR14 protei... 27 7.5 At1g17220.1 68414.m02098 translation initiation factor IF-2, chl... 27 9.9 >At4g02640.2 68417.m00359 bZIP transcription factor family protein contains Pfam profile: PF00170 bZIP transcription factor; identical to cDNA bZIP protein BZO2H1, alternatively spliced GI:10954094 Length = 417 Score = 33.9 bits (74), Expect = 0.065 Identities = 21/72 (29%), Positives = 39/72 (54%) Frame = +2 Query: 299 KNIDDANEDTIKRVCKDYHERIARLEDEKFDLEYIVKRKDMEISDLNSQVNDLRGKFVKP 478 +++D+ NE T +D ++ R+ + +RK + SDL +QVNDL+G+ Sbjct: 205 EDLDEENETTGSLKPEDV-KKSRRMLSNRESARRSRRRKQEQTSDLETQVNDLKGEH-SS 262 Query: 479 TLKKVSKYENKF 514 LK++S +K+ Sbjct: 263 LLKQLSNMNHKY 274 >At4g02640.1 68417.m00358 bZIP transcription factor family protein contains Pfam profile: PF00170 bZIP transcription factor; identical to cDNA bZIP protein BZO2H1, alternatively spliced GI:10954094 Length = 411 Score = 33.9 bits (74), Expect = 0.065 Identities = 21/72 (29%), Positives = 39/72 (54%) Frame = +2 Query: 299 KNIDDANEDTIKRVCKDYHERIARLEDEKFDLEYIVKRKDMEISDLNSQVNDLRGKFVKP 478 +++D+ NE T +D ++ R+ + +RK + SDL +QVNDL+G+ Sbjct: 199 EDLDEENETTGSLKPEDV-KKSRRMLSNRESARRSRRRKQEQTSDLETQVNDLKGEH-SS 256 Query: 479 TLKKVSKYENKF 514 LK++S +K+ Sbjct: 257 LLKQLSNMNHKY 268 >At5g03660.1 68418.m00325 expressed protein low similarity to outer surface protein F [Borrelia burgdorferi] GI:466482; contains Pfam profile PF04949: Family of unknown function (DUF662) Length = 173 Score = 29.9 bits (64), Expect = 1.1 Identities = 14/31 (45%), Positives = 23/31 (74%), Gaps = 1/31 (3%) Frame = +2 Query: 44 DDEKSVSRX-AKKAKQAEIDRKRAEVRKRME 133 DDE S+ A KAK+ EI++K+ E+R+R++ Sbjct: 36 DDELSMKALSAFKAKEEEIEKKKMEIRERVQ 66 >At5g41790.1 68418.m05088 COP1-interactive protein 1 / CIP1 almost identical to CIP1 (GI:836950) [Arabidopsis thaliana] Length = 1305 Score = 29.5 bits (63), Expect = 1.4 Identities = 11/39 (28%), Positives = 27/39 (69%) Frame = +2 Query: 356 ERIARLEDEKFDLEYIVKRKDMEISDLNSQVNDLRGKFV 472 +++A L+ ++ +LE +++K EIS+ SQ+ +L+ + + Sbjct: 879 QQVASLDSQRAELEIQLEKKSEEISEYLSQITNLKEEII 917 >At4g02250.1 68417.m00304 invertase/pectin methylesterase inhibitor family protein low similarity to SP|P83326 Pectinesterase inhibitor (Pectin methylesterase inhibitor) (PMEI) {Actinidia chinensis}, pistil-specific gene sts15 [Solanum tuberosum] GI:1616628; contains Pfam profile PF04043: Plant invertase/pectin methylesterase inhibitor Length = 145 Score = 29.5 bits (63), Expect = 1.4 Identities = 12/29 (41%), Positives = 20/29 (68%) Frame = +2 Query: 293 KPKNIDDANEDTIKRVCKDYHERIARLED 379 K KN++ A EDT+ K+Y + +A+L+D Sbjct: 53 KQKNLEPALEDTLDDCSKNYLDAVAQLDD 81 >At5g57970.1 68418.m07253 methyladenine glycosylase family protein similar to SP|P05100 DNA-3-methyladenine glycosylase I (EC 3.2.2.20) (3-methyladenine-DNA glycosylase I, constitutive) {Escherichia coli}; contains Pfam profile PF03352: Methyladenine glycosylase Length = 347 Score = 28.3 bits (60), Expect = 3.2 Identities = 14/54 (25%), Positives = 29/54 (53%) Frame = +3 Query: 246 NVKLLKGGASSRRGAVNLRTLTTPTKILLRGFAKTTMNASLVLKMKNSIWNTSL 407 +++ L+ +S R G+ + TPT+ + K T+NA+ +L+ N++L Sbjct: 40 SLRKLERSSSGRTGSDEKTSYATPTETVSSSSQKHTLNAASILRRHEQNLNSNL 93 >At2g18900.1 68415.m02205 transducin family protein / WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); related to LACK protective antigen (GI:13625467) [Leishmania donovani] Length = 804 Score = 28.3 bits (60), Expect = 3.2 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +3 Query: 303 TLTTPTKILLRGFAKTTMNASLVLKMKNSIWNTSLKGKIW 422 TLT TK+ G ++ + AS + + + S+WNTS W Sbjct: 577 TLTPITKLCFAGKSEFLVAASHIPRPELSVWNTSKLSLSW 616 >At5g57830.1 68418.m07232 expressed protein contains Pfam profile PF04576: Protein of unknown function, DUF593 Length = 387 Score = 27.9 bits (59), Expect = 4.3 Identities = 16/53 (30%), Positives = 25/53 (47%) Frame = +2 Query: 356 ERIARLEDEKFDLEYIVKRKDMEISDLNSQVNDLRGKFVKPTLKKVSKYENKF 514 E++ E E ++ +K+MEI+ L QV R K + + ENKF Sbjct: 78 EKMCHAETSLVLFEDLIYQKEMEIASLEFQVQAYRCKLLSLGCSDPAVIENKF 130 >At1g79280.1 68414.m09242 expressed protein weak similarity to Nucleoprotein TPR (Swiss-Prot:P12270) [Homo sapiens] Length = 2111 Score = 27.9 bits (59), Expect = 4.3 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +2 Query: 362 IARLEDEKFDLEYIVKRKDMEISDLNSQVNDLRGKFVKPT 481 ++ L K L ++++KD EIS+ NS + K VK T Sbjct: 117 MSELHKSKRQLMELLEQKDAEISEKNSTIKSYLDKIVKLT 156 >At1g77550.1 68414.m09030 tubulin-tyrosine ligase family protein contains tubulin-tyrosine ligase family domain, Pfam:PF03133 Length = 867 Score = 27.9 bits (59), Expect = 4.3 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +2 Query: 323 DTIKRVCKDYHERIARLEDEKFDLEYIV 406 +T ++C+ Y E A + KFDL Y+V Sbjct: 674 ETGPKICQKYIEHPALFKGNKFDLRYVV 701 >At3g07790.1 68416.m00951 DGCR14-related similar to DGCR14 protein (DiGeorge syndrome critical region 14) (ES2 protein) (Swiss-Prot:Q96DF8) [Homo sapiens] Length = 508 Score = 27.1 bits (57), Expect = 7.5 Identities = 14/54 (25%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Frame = +2 Query: 308 DDANEDTIKRVC-KDYHERIARLEDEKFDLEYIVKRKDMEISDLNSQVNDLRGK 466 +DA + I+++ +DY I +L D ++ + R ++I D ++ + RGK Sbjct: 50 EDAYVEAIEKIIERDYFPDITKLRDRLDWIQAVKTRDPIQIRDAQLKIIERRGK 103 >At1g17220.1 68414.m02098 translation initiation factor IF-2, chloroplast, putative similar to SP|P57997|IF2C_PHAVU Translation initiation factor IF-2, chloroplast precursor (PvIF2cp) {Phaseolus vulgaris} Length = 1026 Score = 26.6 bits (56), Expect = 9.9 Identities = 11/49 (22%), Positives = 24/49 (48%) Frame = +2 Query: 293 KPKNIDDANEDTIKRVCKDYHERIARLEDEKFDLEYIVKRKDMEISDLN 439 +P + + + +K +C+DY + + K + E KR+ + DL+ Sbjct: 448 RPDGVHTLDREMVKMICRDYDVEVLDADSVKVE-EMAKKRQTFDEEDLD 495 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,690,837 Number of Sequences: 28952 Number of extensions: 113523 Number of successful extensions: 471 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 456 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 470 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 937669760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -