BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32002 (516 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_39808| Best HMM Match : EGF_CA (HMM E-Value=6.3e-35) 31 0.74 SB_34826| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 30 0.98 SB_10210| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.98 SB_30485| Best HMM Match : fn3 (HMM E-Value=0.0045) 28 5.3 SB_57821| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_2542| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_50769| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 >SB_39808| Best HMM Match : EGF_CA (HMM E-Value=6.3e-35) Length = 850 Score = 30.7 bits (66), Expect = 0.74 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = +1 Query: 193 YCETRHINDRQCYGLRCFNNS 255 +C+ +N R CYG+RC+N + Sbjct: 438 HCDLAMMNGRTCYGVRCYNKT 458 >SB_34826| Best HMM Match : Extensin_2 (HMM E-Value=0.29) Length = 299 Score = 30.3 bits (65), Expect = 0.98 Identities = 22/65 (33%), Positives = 29/65 (44%), Gaps = 9/65 (13%) Frame = -1 Query: 477 QGSSGYTAPDGTPIQITYIAD--ANGY-----QPSGAHL--PTTPAPLPIPDYIARAIEY 325 Q S G+T PIQ +Y A + GY P+ AH P T P+ P Y A Y Sbjct: 14 QHSQGFTTVQNPPIQTSYTAPQASTGYAVQGTAPTAAHYGPPQTQRPVVQPAYSAGTTAY 73 Query: 324 IRTHP 310 ++ P Sbjct: 74 AQSAP 78 >SB_10210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 793 Score = 30.3 bits (65), Expect = 0.98 Identities = 20/54 (37%), Positives = 27/54 (50%), Gaps = 7/54 (12%) Frame = -1 Query: 483 AVQGSSGYTAPDGTPIQITYIAD-----ANGYQPSGAHLPTTPA--PLPIPDYI 343 +V GS G +P GTP+ +A A ++ S A LP T A P P P Y+ Sbjct: 508 SVTGSIGERSPVGTPVASPVVAPVMSPLAAAHRASSASLPVTTAVSPAPEPTYL 561 >SB_30485| Best HMM Match : fn3 (HMM E-Value=0.0045) Length = 514 Score = 27.9 bits (59), Expect = 5.3 Identities = 19/68 (27%), Positives = 28/68 (41%) Frame = -1 Query: 513 VNEGREDASIAVQGSSGYTAPDGTPIQITYIADANGYQPSGAHLPTTPAPLPIPDYIARA 334 ++ G A+ +G+ T P G P Q Y P G H TTP P +Y + Sbjct: 425 LHPGDTHATTTPRGTHATTTPRGVPTQQLY--------PGGTHATTTPRRYPRNNY-TQG 475 Query: 333 IEYIRTHP 310 + + HP Sbjct: 476 VPTQQLHP 483 Score = 27.1 bits (57), Expect = 9.2 Identities = 11/30 (36%), Positives = 13/30 (43%) Frame = -1 Query: 399 PSGAHLPTTPAPLPIPDYIARAIEYIRTHP 310 P G H TTP P DY + + HP Sbjct: 483 PGGTHATTTPRRYPRNDYTQEGVPTQQLHP 512 >SB_57821| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 941 Score = 27.5 bits (58), Expect = 6.9 Identities = 15/40 (37%), Positives = 19/40 (47%), Gaps = 2/40 (5%) Frame = -1 Query: 462 YTAPDGTPIQITYIA--DANGYQPSGAHLPTTPAPLPIPD 349 Y +P T Y A D GY PS +P++P P P D Sbjct: 561 YISPTATAGDRRYPARPDPMGYSPSEMGVPSSPLPRPASD 600 >SB_2542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 761 Score = 27.5 bits (58), Expect = 6.9 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = +3 Query: 417 QQCK*FEWEYHQGQCSRLNLGRRWMHPHG 503 Q + EW +G LN G +W HP G Sbjct: 473 QTVRSMEWRRTKGATPTLNTGPQWGHPKG 501 >SB_50769| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 334 Score = 27.1 bits (57), Expect = 9.2 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = -1 Query: 489 SIAVQGSSGYTAPDGTPIQITYIADANGYQPSGAHLPTTPAP 364 S+ +QG + Y G+ + I A G P GA TTP P Sbjct: 53 SLVIQGVAKYKPGGGSMVLSLIIQGAPGLMPGGA--ATTPGP 92 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,683,249 Number of Sequences: 59808 Number of extensions: 281076 Number of successful extensions: 637 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 599 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 637 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1148326654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -