BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32002 (516 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle pr... 75 4e-16 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 4.3 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 4.3 DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex det... 21 5.7 DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex det... 21 5.7 DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex det... 21 5.7 DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex det... 21 5.7 DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex det... 21 5.7 DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex det... 21 5.7 AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 21 7.5 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 21 10.0 >EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle protein protein. Length = 138 Score = 74.9 bits (176), Expect = 4e-16 Identities = 33/69 (47%), Positives = 44/69 (63%) Frame = -1 Query: 495 DASIAVQGSSGYTAPDGTPIQITYIADANGYQPSGAHLPTTPAPLPIPDYIARAIEYIRT 316 + + QGS YTAPDG + ITY+AD NG+Q G+H+PT P PIP I RA+E+ Sbjct: 66 ETPVVSQGSDSYTAPDGQQVSITYVADENGFQVQGSHIPTAP---PIPPEIQRALEWNAA 122 Query: 315 HPPKPEVGQ 289 HP + + GQ Sbjct: 123 HPEEDDGGQ 131 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.8 bits (44), Expect = 4.3 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = +1 Query: 202 TRHINDRQCYGLRCFNNSRPYQLSYN 279 +RH + GL C N + Y S+N Sbjct: 1454 SRHATSHELKGLLCGNTYQLYLTSHN 1479 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.8 bits (44), Expect = 4.3 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = +1 Query: 202 TRHINDRQCYGLRCFNNSRPYQLSYN 279 +RH + GL C N + Y S+N Sbjct: 1450 SRHATSHELKGLLCGNTYQLYLTSHN 1475 >DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.4 bits (43), Expect = 5.7 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = +1 Query: 229 YGLRCFNNSRPYQLSYNLNTLADL 300 Y +NN+ QL YN+N + + Sbjct: 89 YNYSNYNNNNYKQLCYNINYIEQI 112 >DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.4 bits (43), Expect = 5.7 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = +1 Query: 229 YGLRCFNNSRPYQLSYNLNTLADL 300 Y +NN+ QL YN+N + + Sbjct: 89 YNYSNYNNNNYKQLCYNINYIEQI 112 >DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.4 bits (43), Expect = 5.7 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = +1 Query: 229 YGLRCFNNSRPYQLSYNLNTLADL 300 Y +NN+ QL YN+N + + Sbjct: 89 YNYSNYNNNNYKQLCYNINYIEQI 112 >DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.4 bits (43), Expect = 5.7 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = +1 Query: 229 YGLRCFNNSRPYQLSYNLNTLADL 300 Y +NN+ QL YN+N + + Sbjct: 89 YNYSNYNNNNYKQLCYNINYIEQI 112 >DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.4 bits (43), Expect = 5.7 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = +1 Query: 229 YGLRCFNNSRPYQLSYNLNTLADL 300 Y +NN+ QL YN+N + + Sbjct: 89 YNYSNYNNNNYKQLCYNINHIEQI 112 >DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.4 bits (43), Expect = 5.7 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = +1 Query: 229 YGLRCFNNSRPYQLSYNLNTLADL 300 Y +NN+ QL YN+N + + Sbjct: 89 YNYSNYNNNNYKQLCYNINYIEQI 112 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 21.0 bits (42), Expect = 7.5 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +1 Query: 127 F*LKKKTNKIPVFLTLI 177 F LK K K+PVFL I Sbjct: 546 FSLKFKNKKLPVFLAEI 562 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 20.6 bits (41), Expect = 10.0 Identities = 7/22 (31%), Positives = 13/22 (59%) Frame = +1 Query: 139 KKTNKIPVFLTLIKVYFTYCET 204 K + IP FL+ + ++ YC + Sbjct: 399 KNPDAIPAFLSSLFLWLGYCNS 420 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 137,796 Number of Sequences: 438 Number of extensions: 2911 Number of successful extensions: 12 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14354847 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -