BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31995 (516 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_01_0545 - 4756266-4757510 31 0.55 09_01_0102 + 1582793-1582898,1582988-1583093,1584115-1584172,158... 27 6.8 03_02_0080 + 5498638-5498699,5499121-5499190,5499551-5500711,550... 27 6.8 03_01_0555 + 4132630-4132923,4133514-4133771,4134125-4134249,413... 27 6.8 >05_01_0545 - 4756266-4757510 Length = 414 Score = 31.1 bits (67), Expect = 0.55 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = -1 Query: 408 CKPS**YLRWRRQCS*VYRTSPR*CASFQ-QLYVPAP 301 C P+ Y R RQC+ Y P CA+FQ + +VP+P Sbjct: 346 CLPNRPYQRTPRQCAAFYAAPPVDCAAFQCKPFVPSP 382 >09_01_0102 + 1582793-1582898,1582988-1583093,1584115-1584172, 1584676-1584745,1585132-1585197,1586374-1586429, 1587992-1588078,1588819-1589139,1589827-1589946, 1590747-1590881,1591529-1591605,1591681-1591756, 1592800-1592874,1592971-1593075,1593299-1593374, 1594482-1594617,1594702-1594804,1595186-1595298, 1596907-1597111,1597173-1597301,1597403-1597517, 1597710-1597795,1599108-1599203,1599615-1599751, 1600374-1600476,1601809-1601888,1602013-1602091, 1602241-1602298,1602489-1602586,1602673-1602767, 1602861-1602918 Length = 1074 Score = 27.5 bits (58), Expect = 6.8 Identities = 11/37 (29%), Positives = 21/37 (56%) Frame = +3 Query: 399 RVCKDYHERIARLEDEKFDLEYIVKRKDMEISDLNSQ 509 R+C E+IA +E E D+E I+ ++ ++ N + Sbjct: 649 RLCTSLGEKIAEMESEIADMERIISQRTRDMKKPNDK 685 >03_02_0080 + 5498638-5498699,5499121-5499190,5499551-5500711, 5500940-5501029,5501147-5501464 Length = 566 Score = 27.5 bits (58), Expect = 6.8 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = +1 Query: 310 NVKLLKGGASSRRGAVNLRTLTTPT 384 N K KGGAS+ + A + RT T PT Sbjct: 504 NGKAKKGGASTPKKAAHRRTTTVPT 528 >03_01_0555 + 4132630-4132923,4133514-4133771,4134125-4134249, 4134789-4134990,4135172-4135297,4135404-4135660, 4135968-4136075,4136142-4136310,4136378-4136543, 4136967-4136998,4137256-4137579,4137683-4137757, 4138093-4138162,4138228-4138385,4138872-4139021 Length = 837 Score = 27.5 bits (58), Expect = 6.8 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 387 DTIKRVCKDYHERIARLEDEKFDLEYIV 470 +T ++C+ Y E A + KFDL YIV Sbjct: 643 ETGPKICQKYIECPALFQGRKFDLRYIV 670 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,311,272 Number of Sequences: 37544 Number of extensions: 150028 Number of successful extensions: 456 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 449 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 456 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1118831240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -