BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31988 (516 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_13245| Best HMM Match : Ion_trans (HMM E-Value=3.3e-25) 28 5.3 SB_47942| Best HMM Match : TSP_1 (HMM E-Value=0) 27 9.2 >SB_13245| Best HMM Match : Ion_trans (HMM E-Value=3.3e-25) Length = 816 Score = 27.9 bits (59), Expect = 5.3 Identities = 14/29 (48%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = -1 Query: 255 RTCSLSGLRTASQNH-HPSSSWTHPSLPS 172 +T LS L T S H HP+ W+ P LPS Sbjct: 319 QTSWLSILATESNKHFHPTDPWSGPYLPS 347 >SB_47942| Best HMM Match : TSP_1 (HMM E-Value=0) Length = 2195 Score = 27.1 bits (57), Expect = 9.2 Identities = 30/114 (26%), Positives = 51/114 (44%), Gaps = 12/114 (10%) Frame = -3 Query: 337 TITRTSNANSSPMIVAVTVTTQAFIRRSHLFIVGPP---------YCLSKSP-PIKFLDA 188 T T + ++ +I+ + +TT + S + I+ P + L K+ IK+ D Sbjct: 1715 TTTIITTIINATIIIIIIITTTVIVDISTIIIIIAPSTRGLIIIFFQLDKAYYSIKYGDR 1774 Query: 187 SFTSFMVSF-CV-YIVIGSGMSACFSAITVLTLHPRTVDVTVIDYDRYSLSGHH 32 S++ CV +IVIG + ACF++ L R +D V+ Y G H Sbjct: 1775 IPRSYIGRLICVLWIVIGVILIACFNSTMTTILTARILDKDVMLYGTKVTHGSH 1828 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,988,154 Number of Sequences: 59808 Number of extensions: 339102 Number of successful extensions: 1004 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 910 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1003 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1148326654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -