BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31971 (496 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. 120 8e-30 DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 24 1.0 DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 21 9.5 >AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. Length = 133 Score = 120 bits (289), Expect = 8e-30 Identities = 56/61 (91%), Positives = 59/61 (96%) Frame = -3 Query: 494 VMSGGTXMYPGIADRMQKEIXALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQMWI 315 V+SGGT MYPGIADRMQKEI ALAPST+KIKIIAPPE+KYSVWIGGSILASLSTFQQMWI Sbjct: 73 VLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPEKKYSVWIGGSILASLSTFQQMWI 132 Query: 314 S 312 S Sbjct: 133 S 133 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 23.8 bits (49), Expect = 1.0 Identities = 17/59 (28%), Positives = 27/59 (45%), Gaps = 2/59 (3%) Frame = +3 Query: 138 DGVRLDVQFSGITRYNVLTVAFRTRTSTTPHSTGVT--RPRCLEALAVDDAGAGLVVFL 308 D +LD F T+ N + ++ R++ STT G T + + AL +D FL Sbjct: 354 DSAKLDKIFDIATKENAMLLSGRSQKSTTGPPPGPTPAQKARMRALNIDRVSRVFFPFL 412 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 20.6 bits (41), Expect = 9.5 Identities = 6/19 (31%), Positives = 11/19 (57%) Frame = -2 Query: 393 SPREEVLRMDRWIHPGFPV 337 +P + + + WIHP P+ Sbjct: 531 NPLTDTVPIHTWIHPWLPL 549 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 118,229 Number of Sequences: 438 Number of extensions: 2179 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 13667319 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -