BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31964 (516 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1718.04 |||glycerol-3-phosphate O-acyltransferase |Schizosac... 31 0.10 SPBC27.03 |meu25||sequence orphan|Schizosaccharomyces pombe|chr ... 28 0.95 SPAC13F5.01c |msh1|SPAC23C11.18c|MutS protein homolog 1|Schizosa... 27 1.7 SPCC23B6.03c |tel1||ATM checkpoint kinase|Schizosaccharomyces po... 25 5.1 SPCC645.07 |rgf1||RhoGEF for Rho1, Rgf1|Schizosaccharomyces pomb... 25 6.7 SPBC609.01 |||ribonuclease II |Schizosaccharomyces pombe|chr 2||... 25 6.7 SPAC750.07c |||S. pombe specific GPI anchored protein family 1|S... 25 8.9 >SPBC1718.04 |||glycerol-3-phosphate O-acyltransferase |Schizosaccharomyces pombe|chr 2|||Manual Length = 675 Score = 31.1 bits (67), Expect = 0.10 Identities = 14/65 (21%), Positives = 33/65 (50%) Frame = +3 Query: 147 PGPTESYLRHHPNPAMRAPPNHDYRDTLMKQKVAESVLQRVVGEEAPKVLHKQFNSPINL 326 P P ++ + PNP+ P + + +D K K+ + L++ +G+ ++ + P + Sbjct: 607 PAPLQNVYLYSPNPSALPPSDEEEKDINDKAKLIRNALRQRMGQRMTEIRSRD-TPPEEV 665 Query: 327 YSEQN 341 +SE + Sbjct: 666 FSESD 670 >SPBC27.03 |meu25||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 622 Score = 27.9 bits (59), Expect = 0.95 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +1 Query: 235 NKRWQSRCCSEWLAKRHLRCCTSNSTLQSIYTRN 336 + RW RCC E R L C S T QS N Sbjct: 342 SSRWDFRCCREERLLRLLLCFDSEHTGQSFIQLN 375 >SPAC13F5.01c |msh1|SPAC23C11.18c|MutS protein homolog 1|Schizosaccharomyces pombe|chr 1|||Manual Length = 941 Score = 27.1 bits (57), Expect = 1.7 Identities = 14/47 (29%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = +3 Query: 168 LRHHPNPAMRAPPNHDY-RDTLMKQKVAESVLQRVVGEEAPKVLHKQ 305 L HP+ ++ N+ + LMKQK+ E V+ +EA ++L + Sbjct: 476 LNMHPHDELKQLINNAVDENALMKQKINEEEETEVIAQEAEEILQDE 522 >SPCC23B6.03c |tel1||ATM checkpoint kinase|Schizosaccharomyces pombe|chr 3|||Manual Length = 2812 Score = 25.4 bits (53), Expect = 5.1 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +1 Query: 250 SRCCSEWLAKRHL 288 SRCC+ WL+ HL Sbjct: 2269 SRCCTMWLSNSHL 2281 >SPCC645.07 |rgf1||RhoGEF for Rho1, Rgf1|Schizosaccharomyces pombe|chr 3|||Manual Length = 1334 Score = 25.0 bits (52), Expect = 6.7 Identities = 13/39 (33%), Positives = 17/39 (43%) Frame = +3 Query: 96 PYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAPPNH 212 P PL P ++ R+P P S P+ APP H Sbjct: 44 PVSKKPLPPPTRRLPRKPLPFRSTSLQPPSSQPPAPPTH 82 >SPBC609.01 |||ribonuclease II |Schizosaccharomyces pombe|chr 2|||Manual Length = 1157 Score = 25.0 bits (52), Expect = 6.7 Identities = 17/89 (19%), Positives = 41/89 (46%) Frame = +3 Query: 120 LPGAKVRREPGPTESYLRHHPNPAMRAPPNHDYRDTLMKQKVAESVLQRVVGEEAPKVLH 299 L ++++ +E+YL+ + P P + R+ + ++ + L + + + Sbjct: 52 LQALQMQQSLSESENYLQPNFFPFQSGPFSKSRRENTLLPRL--NPLAPIGARQPNPSIP 109 Query: 300 KQFNSPINLYSEQNIANSIRQQTSPLPTN 386 +QF+ PIN + ++ + TSP+ N Sbjct: 110 QQFSKPINESGTGTMGPAVGELTSPVMKN 138 >SPAC750.07c |||S. pombe specific GPI anchored protein family 1|Schizosaccharomyces pombe|chr 1|||Manual Length = 123 Score = 24.6 bits (51), Expect = 8.9 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = -3 Query: 301 LCNTLGASSPTTR 263 L NTLG SSPTT+ Sbjct: 90 LVNTLGGSSPTTK 102 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,176,705 Number of Sequences: 5004 Number of extensions: 45817 Number of successful extensions: 128 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 124 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 128 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 208287218 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -