BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31960 (516 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC005171-1|AAH05171.2| 647|Homo sapiens chaperone, ABC1 activit... 29 9.7 AL353689-5|CAI19106.1| 492|Homo sapiens chaperone, ABC1 activit... 29 9.7 AL353689-4|CAI19105.1| 595|Homo sapiens chaperone, ABC1 activit... 29 9.7 AL353689-3|CAI19104.1| 572|Homo sapiens chaperone, ABC1 activit... 29 9.7 AL353689-2|CAI19103.1| 647|Homo sapiens chaperone, ABC1 activit... 29 9.7 AK074693-1|BAC11143.1| 647|Homo sapiens protein ( Homo sapiens ... 29 9.7 AJ278126-1|CAC00482.1| 368|Homo sapiens hypothetical protein pr... 29 9.7 AB073905-1|BAB91363.1| 647|Homo sapiens chaperone-ABC1-like pro... 29 9.7 >BC005171-1|AAH05171.2| 647|Homo sapiens chaperone, ABC1 activity of bc1 complex homolog (S. pombe) protein. Length = 647 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = -2 Query: 416 SSGLVQEFKN*MMYNVLMCSLNNAVDLGLCELTPSW 309 + GL QE +N + YN+L+ L + + P+W Sbjct: 456 AEGLSQEIRNEICYNILVLCLRELFEFHFMQTDPNW 491 >AL353689-5|CAI19106.1| 492|Homo sapiens chaperone, ABC1 activity of bc1 complex homolog (S. pombe) protein. Length = 492 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = -2 Query: 416 SSGLVQEFKN*MMYNVLMCSLNNAVDLGLCELTPSW 309 + GL QE +N + YN+L+ L + + P+W Sbjct: 301 AEGLSQEIRNEICYNILVLCLRELFEFHFMQTDPNW 336 >AL353689-4|CAI19105.1| 595|Homo sapiens chaperone, ABC1 activity of bc1 complex homolog (S. pombe) protein. Length = 595 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = -2 Query: 416 SSGLVQEFKN*MMYNVLMCSLNNAVDLGLCELTPSW 309 + GL QE +N + YN+L+ L + + P+W Sbjct: 404 AEGLSQEIRNEICYNILVLCLRELFEFHFMQTDPNW 439 >AL353689-3|CAI19104.1| 572|Homo sapiens chaperone, ABC1 activity of bc1 complex homolog (S. pombe) protein. Length = 572 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = -2 Query: 416 SSGLVQEFKN*MMYNVLMCSLNNAVDLGLCELTPSW 309 + GL QE +N + YN+L+ L + + P+W Sbjct: 381 AEGLSQEIRNEICYNILVLCLRELFEFHFMQTDPNW 416 >AL353689-2|CAI19103.1| 647|Homo sapiens chaperone, ABC1 activity of bc1 complex homolog (S. pombe) protein. Length = 647 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = -2 Query: 416 SSGLVQEFKN*MMYNVLMCSLNNAVDLGLCELTPSW 309 + GL QE +N + YN+L+ L + + P+W Sbjct: 456 AEGLSQEIRNEICYNILVLCLRELFEFHFMQTDPNW 491 >AK074693-1|BAC11143.1| 647|Homo sapiens protein ( Homo sapiens cDNA FLJ90212 fis, clone MAMMA1002128, weakly similar to ABC1 PROTEIN HOMOLOG PRECURSOR. ). Length = 647 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = -2 Query: 416 SSGLVQEFKN*MMYNVLMCSLNNAVDLGLCELTPSW 309 + GL QE +N + YN+L+ L + + P+W Sbjct: 456 AEGLSQEIRNEICYNILVLCLRELFEFHFMQTDPNW 491 >AJ278126-1|CAC00482.1| 368|Homo sapiens hypothetical protein protein. Length = 368 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = -2 Query: 416 SSGLVQEFKN*MMYNVLMCSLNNAVDLGLCELTPSW 309 + GL QE +N + YN+L+ L + + P+W Sbjct: 177 AEGLSQEIRNEICYNILVLCLRELFEFHFMQTDPNW 212 >AB073905-1|BAB91363.1| 647|Homo sapiens chaperone-ABC1-like protein. Length = 647 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = -2 Query: 416 SSGLVQEFKN*MMYNVLMCSLNNAVDLGLCELTPSW 309 + GL QE +N + YN+L+ L + + P+W Sbjct: 456 AEGLSQEIRNEICYNILVLCLRELFEFHFMQTDPNW 491 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 66,529,367 Number of Sequences: 237096 Number of extensions: 1252551 Number of successful extensions: 1455 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1438 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1455 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4876707572 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -