BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31960 (516 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g14365.1 68417.m02213 zinc finger (C3HC4-type RING finger) fa... 27 7.5 At3g23060.1 68416.m02907 zinc finger (C3HC4-type RING finger) fa... 27 9.9 >At4g14365.1 68417.m02213 zinc finger (C3HC4-type RING finger) family protein / ankyrin repeat family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) and Pfam profile: PF00023 ankyrin repeat Length = 376 Score = 27.1 bits (57), Expect = 7.5 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +3 Query: 276 CIRCRIQLELKPRGCELTQAKINCVIQ*AH 365 CI C ++E K GC + +A I+ VI+ H Sbjct: 346 CISCLKEIENKKMGCPVCRANIDQVIKLYH 375 >At3g23060.1 68416.m02907 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 480 Score = 26.6 bits (56), Expect = 9.9 Identities = 9/32 (28%), Positives = 19/32 (59%) Frame = +1 Query: 52 LCNNPYQKKILMLRRLHITCQSILYDKSLSDR 147 +C NP++ + LH C+S + +K +++R Sbjct: 18 ICTNPFKDATTISECLHTFCRSCIRNKFINER 49 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,016,422 Number of Sequences: 28952 Number of extensions: 177189 Number of successful extensions: 273 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 271 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 273 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 937669760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -