BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31956 (516 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_22295| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_45684| Best HMM Match : T-box (HMM E-Value=1.5e-32) 27 6.9 >SB_22295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 467 Score = 27.9 bits (59), Expect = 5.3 Identities = 11/43 (25%), Positives = 22/43 (51%) Frame = +3 Query: 84 HTWVQTSGDTYSILEALNKTLSVVLDASIEYTSADAVSAVTSY 212 H+W + G + ++ EAL K + L ++ T + +S V + Sbjct: 346 HSWTRQGGKSRALYEALKKLFDIALRRNLHITFSYVLSNVPGF 388 >SB_45684| Best HMM Match : T-box (HMM E-Value=1.5e-32) Length = 337 Score = 27.5 bits (58), Expect = 6.9 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +1 Query: 325 VTSYVCTDKPRHTFNTRSAKQISINHFRFFQSI 423 + S+ D+PR ++ +S K IS HF F S+ Sbjct: 89 IASHAIVDRPRASWKRQSLKGISNFHFLAFSSL 121 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,418,548 Number of Sequences: 59808 Number of extensions: 249009 Number of successful extensions: 635 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 585 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 635 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1148326654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -