BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31956 (516 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g10110.1 68415.m01050 hypothetical protein 27 5.7 At1g21850.1 68414.m02735 multi-copper oxidase type I family prot... 27 5.7 At1g36180.1 68414.m04497 acetyl-CoA carboxylase 2 (ACC2) nearly ... 27 7.5 At1g41830.1 68414.m04829 multi-copper oxidase type I family prot... 27 9.9 >At2g10110.1 68415.m01050 hypothetical protein Length = 169 Score = 27.5 bits (58), Expect = 5.7 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +2 Query: 356 VIHSTLEALNKSLSTILDSSNQYTYAHL 439 +IHST + KS STI+ S Y+ A L Sbjct: 66 IIHSTNHSTTKSSSTIIHHSTSYSTASL 93 >At1g21850.1 68414.m02735 multi-copper oxidase type I family protein similar to pollen-specific BP10 protein [SP|Q00624][Brassica napus]; contains Pfam profile: PF00394 Multicopper oxidase Length = 551 Score = 27.5 bits (58), Expect = 5.7 Identities = 10/31 (32%), Positives = 19/31 (61%) Frame = -3 Query: 205 VTADTASADVYSIEASKTTDRVLFSASSIEY 113 +TAD + D Y + +S+ T ++L +A + Y Sbjct: 264 ITADQPAKDYYIVVSSRFTSKILITAGVLHY 294 >At1g36180.1 68414.m04497 acetyl-CoA carboxylase 2 (ACC2) nearly identical to acetyl-CoA carboxylase 2 (ACC2) [Arabidopsis thaliana] GI:11869928 Length = 1755 Score = 27.1 bits (57), Expect = 7.5 Identities = 23/89 (25%), Positives = 36/89 (40%), Gaps = 5/89 (5%) Frame = +3 Query: 93 VQTSGDTYSILEALNKTLSVVLDASIEYTSADAVSAVTSYV-----GTDKPRHIFNTRSA 257 +Q SGD E +NK ++ + + T A V S + G RH F+ Sbjct: 690 LQDSGDEDQTQERVNKLAKILKEEEVSLTLCSAGVGVISCIIQRDEGRTPMRHSFHWLME 749 Query: 258 KQNYRPF*ILLLNTHRLMLYVSCDVIRVY 344 KQ Y +L L +Y+ D ++ Y Sbjct: 750 KQYYVEEPLLRHVEPPLSVYLELDKLKGY 778 >At1g41830.1 68414.m04829 multi-copper oxidase type I family protein similar to pollen-specific BP10 protein [SP|Q00624][Brassica napus]; contains Pfam profile: PF00394 Multicopper oxidase Length = 542 Score = 26.6 bits (56), Expect = 9.9 Identities = 9/31 (29%), Positives = 19/31 (61%) Frame = -3 Query: 205 VTADTASADVYSIEASKTTDRVLFSASSIEY 113 +TAD + D Y + +S+ TD+++ + + Y Sbjct: 264 ITADQSPRDYYVVVSSRFTDKIITTTGVLRY 294 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,006,580 Number of Sequences: 28952 Number of extensions: 154824 Number of successful extensions: 337 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 326 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 337 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 937669760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -