BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31953 (516 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglu... 21 4.9 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 21 8.6 >EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglucosaminidase NAG3 protein. Length = 582 Score = 21.4 bits (43), Expect = 4.9 Identities = 7/18 (38%), Positives = 13/18 (72%) Frame = -3 Query: 103 HGHQIL*SSCQYFVL*CG 50 HGH+++ S+ ++ L CG Sbjct: 451 HGHRVIYSTVGHWYLDCG 468 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 20.6 bits (41), Expect = 8.6 Identities = 9/28 (32%), Positives = 13/28 (46%) Frame = +1 Query: 370 VYWFSLTRHDFNWNLTLYLC*SRLTIRL 453 +Y+F FN +L LC T+ L Sbjct: 56 IYYFYCVSITFNVHLLFLLCSGYFTVHL 83 Score = 20.6 bits (41), Expect = 8.6 Identities = 11/38 (28%), Positives = 17/38 (44%) Frame = -3 Query: 364 WYLVYFPQFVSNATIICVYIYFKWCIYMCFPCEAFFTI 251 ++L+ F I V++ F CIY F FT+ Sbjct: 141 FFLLCIYYFYCAFIIFTVHLLFLLCIYHFFCAFIIFTM 178 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 130,711 Number of Sequences: 336 Number of extensions: 3161 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12363686 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -