BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31953 (516 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. 23 2.5 AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly pro... 23 2.5 AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly pro... 23 2.5 EF032397-1|ABM97933.1| 200|Apis mellifera arginine kinase protein. 21 7.5 AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. 21 7.5 >D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. Length = 432 Score = 22.6 bits (46), Expect = 2.5 Identities = 17/68 (25%), Positives = 31/68 (45%), Gaps = 1/68 (1%) Frame = +2 Query: 113 NISVYKCDLNKEKLTQLPNTLWKSVNKYINF-ILNVNNPLFTIWKVRYRKECFTRKTHVN 289 ++ ++ +N+E + L N + K VN NF +N + ++ C + Sbjct: 365 HVPIFDRYINREYILVLSNKMQKMVNNDFNFDDVNFRIMNANVNELILNTRC-ENPDNDR 423 Query: 290 TPFKIYIN 313 TPFKI I+ Sbjct: 424 TPFKISIH 431 >AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 22.6 bits (46), Expect = 2.5 Identities = 17/68 (25%), Positives = 31/68 (45%), Gaps = 1/68 (1%) Frame = +2 Query: 113 NISVYKCDLNKEKLTQLPNTLWKSVNKYINF-ILNVNNPLFTIWKVRYRKECFTRKTHVN 289 ++ ++ +N+E + L N + K VN NF +N + ++ C + Sbjct: 365 HVPIFDRYINREYILVLSNKMQKMVNNDFNFDDVNFRIMNANVNELILNTRC-ENPDNDR 423 Query: 290 TPFKIYIN 313 TPFKI I+ Sbjct: 424 TPFKISIH 431 >AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 22.6 bits (46), Expect = 2.5 Identities = 17/68 (25%), Positives = 31/68 (45%), Gaps = 1/68 (1%) Frame = +2 Query: 113 NISVYKCDLNKEKLTQLPNTLWKSVNKYINF-ILNVNNPLFTIWKVRYRKECFTRKTHVN 289 ++ ++ +N+E + L N + K VN NF +N + ++ C + Sbjct: 365 HVPIFDRYINREYILVLSNKMQKMVNNDFNFDDVNFRIMNANVNELILNTRC-ENPDNDR 423 Query: 290 TPFKIYIN 313 TPFKI I+ Sbjct: 424 TPFKISIH 431 >EF032397-1|ABM97933.1| 200|Apis mellifera arginine kinase protein. Length = 200 Score = 21.0 bits (42), Expect = 7.5 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -1 Query: 105 HTGIKYYDRHVNILFYDADTIG 40 H G K D+H F D D++G Sbjct: 73 HGGFKKTDKHPPKDFGDVDSLG 94 >AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. Length = 355 Score = 21.0 bits (42), Expect = 7.5 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -1 Query: 105 HTGIKYYDRHVNILFYDADTIG 40 H G K D+H F D D++G Sbjct: 89 HGGFKKTDKHPPKDFGDVDSLG 110 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,723 Number of Sequences: 438 Number of extensions: 3574 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14354847 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -