BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31952 (505 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 24 2.5 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 24 2.5 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 24.2 bits (50), Expect = 2.5 Identities = 15/54 (27%), Positives = 23/54 (42%), Gaps = 2/54 (3%) Frame = +1 Query: 109 VHVAKQKQTQKEVVGDKEITRKIT--STETTEIEHKAQTQERVVEGPVKPSKPP 264 V K + +EV D+ + + T TT ++A +GPV KPP Sbjct: 1184 VKCRKSGNSHQEVPADELMKKDATLGGNATTSTSNEAHVIANGHDGPVSAGKPP 1237 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 24.2 bits (50), Expect = 2.5 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +2 Query: 65 QEYRILRNRPCTAKKCTLRNKNKL 136 + YRI + CTA KC LR KL Sbjct: 2230 RNYRIAK---CTAAKCALRQLKKL 2250 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.314 0.130 0.372 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 508,222 Number of Sequences: 2352 Number of extensions: 10955 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 45245913 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (22.0 bits)
- SilkBase 1999-2023 -